BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0652 (607 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 23 1.5 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.5 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 22 3.5 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 23.4 bits (48), Expect = 1.5 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = -1 Query: 193 PANGEGSLIACITYGSYSFACTEP 122 P G G L C+ +S C EP Sbjct: 341 PQEGLGELAVCVNERPWSLYCGEP 364 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 1.5 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 448 SSITHPTTTVAATFKRKMEKLTSYPDSS*TVF 543 S+ T PTTTV+ K + YP S + F Sbjct: 1190 STTTRPTTTVSQLIDDKCDSGQYYPHESCSSF 1221 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 22.2 bits (45), Expect = 3.5 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = -3 Query: 374 HLAFFGRPVSVSSVSNLTFSAKSFEEI 294 HL+ G P++ S ++L +A EE+ Sbjct: 517 HLSLEGNPITTLSNTSLLGAANQLEEL 543 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,731 Number of Sequences: 336 Number of extensions: 3073 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15352827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -