BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0651 (595 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26507| Best HMM Match : Ala_racemase_N (HMM E-Value=0.39) 76 1e-24 SB_49250| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_5082| Best HMM Match : Fn_bind (HMM E-Value=6.8) 30 1.6 SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_810| Best HMM Match : TAF4 (HMM E-Value=4.7e-31) 29 2.8 SB_24434| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_18608| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_20297| Best HMM Match : LCCL (HMM E-Value=9.7) 28 6.5 SB_17067| Best HMM Match : TP2 (HMM E-Value=4.1) 28 6.5 SB_17066| Best HMM Match : PHD (HMM E-Value=1.6) 28 6.5 SB_54549| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) 27 8.6 SB_45719| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_26507| Best HMM Match : Ala_racemase_N (HMM E-Value=0.39) Length = 195 Score = 76.2 bits (179), Expect(2) = 1e-24 Identities = 35/60 (58%), Positives = 45/60 (75%) Frame = +2 Query: 95 DIMYGLKTVLSQIEIAVARRSKDLPQIAPRLVAVSKIKPVELIVEAYNAGQRHFGENYVN 274 +I LKTVL +I +R ++L ++ PRLVAVSK KP+E I+EAYN GQRHFGENYV+ Sbjct: 9 NIGLALKTVLQKINEVAEKRPENLQKLVPRLVAVSKTKPIECIIEAYNNGQRHFGENYVS 68 Score = 54.4 bits (125), Expect(2) = 1e-24 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = +2 Query: 386 PGLFMVETVDSEKLADNLNKQWLKYRKEKERLRVMVQVNTSGEQ 517 P L+MVETVDSEKLA LN W K+ +E L+VMV+VNTS E+ Sbjct: 70 PNLYMVETVDSEKLAATLNNSWGKF-PNREPLKVMVEVNTSEEK 112 >SB_49250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 638 Score = 30.7 bits (66), Expect = 0.93 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +2 Query: 404 ETVDSEKLADNLNKQWLKYRKEKERL-RVMVQVNTSGEQAKSGLEPLETTK 553 ET +K + LNK+ + K+KERL +V ++N E+ +E L+ T+ Sbjct: 543 ETERLDKTRERLNKERKRLNKKKERLNKVRKRLNKEKERLNKEMERLDKTR 593 >SB_5082| Best HMM Match : Fn_bind (HMM E-Value=6.8) Length = 367 Score = 29.9 bits (64), Expect = 1.6 Identities = 22/81 (27%), Positives = 46/81 (56%), Gaps = 5/81 (6%) Frame = +2 Query: 263 NYVNELSDKASDPLILEKCKDI-KWHFI---GHLQTNKINKLLGSPGLFMVETVDSEKLA 430 N+ ++LS+K+S+ + + K +I G++ NK+ +L G ++ + + ++ Sbjct: 2 NHTSQLSEKSSNRDRNDHATSVGKLGYITENGYVDLNKVQLVLSELG-YVEDEIFKKRQQ 60 Query: 431 DNLN-KQWLKYRKEKERLRVM 490 DN+ K+ LK KE+ER++ M Sbjct: 61 DNIAYKKRLKANKERERIQKM 81 >SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1480 Score = 29.5 bits (63), Expect = 2.1 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = +2 Query: 101 MYGLKTVLSQIEIAVARRSKDLPQIAPRLVAVSKIKPVELIVEAYNAG 244 M +K + IAVA LP +A RLV +KIK +++ A+ AG Sbjct: 51 MVEVKDKMETTRIAVATGKVLLPTVAFRLVKENKIKKGDVLTTAHLAG 98 >SB_810| Best HMM Match : TAF4 (HMM E-Value=4.7e-31) Length = 883 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/60 (23%), Positives = 33/60 (55%) Frame = +2 Query: 119 VLSQIEIAVARRSKDLPQIAPRLVAVSKIKPVELIVEAYNAGQRHFGENYVNELSDKASD 298 +++ +++ S PQ+ P++ V+ P+E+I E + A ++F N + S+K+ + Sbjct: 319 IVNSQAVSIGNSSSPAPQVQPQVKIVNTPIPIEVIKE-HAAKLKNFFNNLIRLASEKSPE 377 >SB_24434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1194 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/59 (28%), Positives = 25/59 (42%) Frame = +2 Query: 356 TNKINKLLGSPGLFMVETVDSEKLADNLNKQWLKYRKEKERLRVMVQVNTSGEQAKSGL 532 + K K+ GS GL MV S ++A N W+KY + + G +K L Sbjct: 73 SGKDKKVYGSYGLAMVLRCPSHQVALGANYTWIKYNHVSNTWEPLAESKYYGVTSKGDL 131 >SB_18608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 574 Score = 28.7 bits (61), Expect = 3.7 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = +2 Query: 416 SEKLADNLNKQWLKYRKEKERLRVMVQVNTSGEQAKSGLEPLETTK 553 ++KLA L K+ +EKE ++ + V T+ +Q +E L+ TK Sbjct: 65 AQKLARELMLYKQKHEREKELVKSLKLVETTRDQTLEEIEQLQRTK 110 >SB_20297| Best HMM Match : LCCL (HMM E-Value=9.7) Length = 100 Score = 27.9 bits (59), Expect = 6.5 Identities = 14/60 (23%), Positives = 33/60 (55%) Frame = +2 Query: 413 DSEKLADNLNKQWLKYRKEKERLRVMVQVNTSGEQAKSGLEPLETTKAVEHILENCPNLD 592 D E+L+ + ++ +R +ER+ ++++SG +++G+ K +E+ PNL+ Sbjct: 9 DRERLSSD-SQPSSDFRNRRERVDSSSEISSSGYYSENGISGKRKQKKKVTFVESAPNLE 67 >SB_17067| Best HMM Match : TP2 (HMM E-Value=4.1) Length = 330 Score = 27.9 bits (59), Expect = 6.5 Identities = 14/60 (23%), Positives = 33/60 (55%) Frame = +2 Query: 413 DSEKLADNLNKQWLKYRKEKERLRVMVQVNTSGEQAKSGLEPLETTKAVEHILENCPNLD 592 D E+L+ + ++ +R +ER+ ++++SG +++G+ K +E+ PNL+ Sbjct: 239 DRERLSSD-SQPSSDFRNRRERVDSSSEISSSGYYSENGISGKRKQKKKVTFVESAPNLE 297 >SB_17066| Best HMM Match : PHD (HMM E-Value=1.6) Length = 523 Score = 27.9 bits (59), Expect = 6.5 Identities = 14/60 (23%), Positives = 33/60 (55%) Frame = +2 Query: 413 DSEKLADNLNKQWLKYRKEKERLRVMVQVNTSGEQAKSGLEPLETTKAVEHILENCPNLD 592 D E+L+ + ++ +R +ER+ ++++SG +++G+ K +E+ PNL+ Sbjct: 165 DRERLSSD-SQPSSDFRNRRERVDSSSEISSSGYYSENGISGKRKQKKKVTFVESAPNLE 223 >SB_54549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 423 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = -2 Query: 549 VVSNGSKPLFACSPLVLTCTITLNLSFS 466 VVS+ S+P+F V++C + L+LS+S Sbjct: 368 VVSSQSRPIFTRDLRVVSCQVCLHLSWS 395 >SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 3312 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -2 Query: 585 FGQFSRMCSTAFVVSNGSKPLFACSP-LVLTCTITLNLSFSF 463 FG +S CS F +++ K AC LV++ T+ L F++ Sbjct: 598 FGSYSCSCSPGFALADDKKSCKACKDNLVMSKINTMPLCFAY 639 >SB_45719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 429 Score = 27.5 bits (58), Expect = 8.6 Identities = 16/64 (25%), Positives = 31/64 (48%) Frame = +2 Query: 59 LQLMTSEVDAKVDIMYGLKTVLSQIEIAVARRSKDLPQIAPRLVAVSKIKPVELIVEAYN 238 L+ T+E+D D LKT+L Q ++ + ++ + + V V+K +E + N Sbjct: 186 LEAATTEMDKIADEYTKLKTILQQSDLILEEMRRERDALRAQAVLVAKDIEIEQYKDMVN 245 Query: 239 AGQR 250 Q+ Sbjct: 246 GLQQ 249 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,601,245 Number of Sequences: 59808 Number of extensions: 308904 Number of successful extensions: 853 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 814 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 851 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -