BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0648 (570 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 24 3.0 AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 23 5.3 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 23 7.0 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 24.2 bits (50), Expect = 3.0 Identities = 15/42 (35%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 124 TSSTRNDPLASYQSICAAPHSPGWSASSWQE--SAGTPTCQT 243 T ST + P + S C P S WS S A T +C T Sbjct: 47 TRSTPSSPRLAQASTCPVPCSSIWSRPSSMRCAPARTASCST 88 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 23.4 bits (48), Expect = 5.3 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +1 Query: 262 KHQSVRLQRVSSPAYGLVRQPRHLP 336 KH + V PAY + R P H P Sbjct: 397 KHVIPKRTLVQIPAYAIQRDPDHYP 421 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.0 bits (47), Expect = 7.0 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = -3 Query: 397 VLYGLVCALTTNCGPLLVVRAEDVVAAVQGHMPATILAAIE 275 ++Y V + G ++ A+D+V V G P T AA E Sbjct: 714 MMYDGVFGVGLPLGAEIIGYADDLVLLVPGTTPTTAAAAAE 754 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 597,252 Number of Sequences: 2352 Number of extensions: 12303 Number of successful extensions: 27 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -