BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0647 (592 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1B3.08 |||COP9 signalosome complex subunit 12 |Schizosacchar... 28 0.89 SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyce... 28 1.2 SPBC800.02 |whi5|mug54|cell cycle transcriptional repressor Whi5... 25 6.2 SPAC1142.03c |swi2|SPAC17G6.20c|Swi5 complex subunit Swi2|Schizo... 25 8.3 SPBC1861.04c |||RNA-binding protein Prp24|Schizosaccharomyces po... 25 8.3 SPBP8B7.28c |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 25 8.3 SPCC320.08 |||membrane transporter |Schizosaccharomyces pombe|ch... 25 8.3 >SPAC1B3.08 |||COP9 signalosome complex subunit 12 |Schizosaccharomyces pombe|chr 1|||Manual Length = 423 Score = 28.3 bits (60), Expect = 0.89 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = +1 Query: 487 PVTEQLRSARLGWYGRVMRRNENEVGKSE 573 P+T L+S LG +G+ +++NE + K++ Sbjct: 306 PLTRALKSGNLGEFGKCLQKNETLLAKTK 334 >SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1347 Score = 27.9 bits (59), Expect = 1.2 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = +3 Query: 243 YRYTEISNRAINKLYCCDRLKSHRP*NRCDAYKVFRMKNVLNIVTKVADERRLH 404 Y E+ +R I+ Y C ++ NR + F +K V +T++ ++R+H Sbjct: 886 YHAEELYSRCID--YACHNIEFFLEANRISEWDGFHLKKVAQRLTELLSDQRVH 937 >SPBC800.02 |whi5|mug54|cell cycle transcriptional repressor Whi5|Schizosaccharomyces pombe|chr 2|||Manual Length = 252 Score = 25.4 bits (53), Expect = 6.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -2 Query: 453 PFSLLHTSIATLASPLHAIAFH 388 PF L H S A+ SPL + +H Sbjct: 173 PFELSHASTASAKSPLFGMNYH 194 >SPAC1142.03c |swi2|SPAC17G6.20c|Swi5 complex subunit Swi2|Schizosaccharomyces pombe|chr 1|||Manual Length = 722 Score = 25.0 bits (52), Expect = 8.3 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -2 Query: 546 SSHHTSIPSQTRTSQLLCHRCHFQTSSNIFYPFSLLHTSIATLASPLH 403 S+H I T + +L + + SN+ SL++ S+ +L S +H Sbjct: 493 SNHSNIIKPNTYKNTILSNENNTPNYSNVCLSTSLINRSLPSLKSTMH 540 >SPBC1861.04c |||RNA-binding protein Prp24|Schizosaccharomyces pombe|chr 2|||Manual Length = 1014 Score = 25.0 bits (52), Expect = 8.3 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = -3 Query: 518 KRALLSCSVTGVTFRLPLTYSIHSRYSTHPSQHWHLRCMQSPFIRHFSHNIKY 360 +RA +CS G + + LTY S ST RC+ S + +F I + Sbjct: 331 ERATRNCSWIGRIWSIKLTYMTLSGASTSAVCEEKDRCLNSNLLVNFDEVIDF 383 >SPBP8B7.28c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 215 Score = 25.0 bits (52), Expect = 8.3 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = -3 Query: 431 PSQH---WHLRCMQSPFIRHFSHNIKYILHSKYFICI 330 P QH W C Q+ I FS +++L + IC+ Sbjct: 85 PKQHDSIWCTACQQTKGINEFSKAQRHVLDPRCQICV 121 >SPCC320.08 |||membrane transporter |Schizosaccharomyces pombe|chr 3|||Manual Length = 505 Score = 25.0 bits (52), Expect = 8.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 480 FQTSSNIFYPFSLLHTSIATLASPLHAIAFH 388 F+ SS FY SLL + +L +H +H Sbjct: 382 FRMSSATFYNISLLTSDFWSLVIGIHVFGYH 412 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,491,961 Number of Sequences: 5004 Number of extensions: 51643 Number of successful extensions: 139 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 139 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 256184654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -