BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0647 (592 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 27 0.45 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 27 0.45 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 27 0.45 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 27 0.45 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 27 0.45 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 27 0.45 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 27 0.45 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 26 1.0 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 26 1.0 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 26 1.0 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 26 1.0 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 26 1.0 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 26 1.0 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 25 2.4 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 24 4.2 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 9.8 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 27.1 bits (57), Expect = 0.45 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -1 Query: 580 VNTHSYQPHFHFVSSHVHTIPNAHFSAALS 491 V+++++ P H H H P AH+SA ++ Sbjct: 163 VSSYAHAPVAHATVQHHHAAPIAHYSAPIA 192 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 27.1 bits (57), Expect = 0.45 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -1 Query: 580 VNTHSYQPHFHFVSSHVHTIPNAHFSAALS 491 V+++++ P H H H P AH+SA ++ Sbjct: 171 VSSYAHAPVAHATVQHHHAAPIAHYSAPIA 200 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 27.1 bits (57), Expect = 0.45 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -1 Query: 580 VNTHSYQPHFHFVSSHVHTIPNAHFSAALS 491 V+++++ P H H H P AH+SA ++ Sbjct: 171 VSSYAHAPVAHATVQHHHAAPIAHYSAPIA 200 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 27.1 bits (57), Expect = 0.45 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -1 Query: 580 VNTHSYQPHFHFVSSHVHTIPNAHFSAALS 491 V+++++ P H H H P AH+SA ++ Sbjct: 195 VSSYAHAPVAHATVQHHHAAPIAHYSAPIA 224 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 27.1 bits (57), Expect = 0.45 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -1 Query: 580 VNTHSYQPHFHFVSSHVHTIPNAHFSAALS 491 V+++++ P H H H P AH+SA ++ Sbjct: 163 VSSYAHAPVAHATVQHHHAAPIAHYSAPIA 192 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 27.1 bits (57), Expect = 0.45 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -1 Query: 580 VNTHSYQPHFHFVSSHVHTIPNAHFSAALS 491 V+++++ P H H H P AH+SA ++ Sbjct: 171 VSSYAHAPVAHATVQHHHAAPIAHYSAPIA 200 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 27.1 bits (57), Expect = 0.45 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -1 Query: 580 VNTHSYQPHFHFVSSHVHTIPNAHFSAALS 491 V+++++ P H H H P AH+SA ++ Sbjct: 163 VSSYAHAPVAHATVQHHHAAPIAHYSAPIA 192 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 25.8 bits (54), Expect = 1.0 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -1 Query: 580 VNTHSYQPHFHFVSSHVHTIPNAHFSAALS 491 V+++++ P H H H P AH++A ++ Sbjct: 171 VSSYAHAPVAHATVQHHHAAPIAHYAAPIA 200 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 25.8 bits (54), Expect = 1.0 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -1 Query: 580 VNTHSYQPHFHFVSSHVHTIPNAHFSAALS 491 V+++++ P H H H P AH++A ++ Sbjct: 163 VSSYAHAPVAHATVQHHHAAPIAHYAAPIA 192 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 25.8 bits (54), Expect = 1.0 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -1 Query: 571 HSYQPHFHFVSSHVHTIPNAHFSAALS 491 H + P H H H P AH+SA ++ Sbjct: 162 HVHAPVAHATVQHHHAAPIAHYSAPIA 188 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 25.8 bits (54), Expect = 1.0 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -1 Query: 580 VNTHSYQPHFHFVSSHVHTIPNAHFSAALS 491 V+++++ P H H H P AH++A ++ Sbjct: 163 VSSYAHAPVAHATVQHHHAAPIAHYAAPIA 192 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 25.8 bits (54), Expect = 1.0 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -1 Query: 580 VNTHSYQPHFHFVSSHVHTIPNAHFSAALS 491 V+++++ P H H H P AH++A ++ Sbjct: 163 VSSYAHAPVAHATVQHHHAAPIAHYAAPIA 192 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 25.8 bits (54), Expect = 1.0 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -1 Query: 580 VNTHSYQPHFHFVSSHVHTIPNAHFSAALS 491 V+++++ P H H H P AH++A ++ Sbjct: 171 VSSYAHAPVAHATVQHHHAAPIAHYAAPIA 200 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 24.6 bits (51), Expect = 2.4 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = -3 Query: 446 RYSTHPSQHWHLRCMQSPFIRHFSHNIKYILHSK 345 RY H +HL ++ ++ F+ +K+++HS+ Sbjct: 508 RYDAHD---YHLHTGRNAMVKEFATKLKHLVHSR 538 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.8 bits (49), Expect = 4.2 Identities = 6/30 (20%), Positives = 19/30 (63%) Frame = -3 Query: 434 HPSQHWHLRCMQSPFIRHFSHNIKYILHSK 345 + + +HL ++ ++ F+ +K+++HS+ Sbjct: 509 YDANDYHLHAGRNAMVKEFAAKLKHLVHSR 538 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 22.6 bits (46), Expect = 9.8 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = -1 Query: 130 TNNDKSLKYVNKLILLLCIVRC 65 T DK+L+++ K+I + C+ C Sbjct: 769 TFKDKALEFLMKMIDIFCVWDC 790 Score = 22.6 bits (46), Expect = 9.8 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 261 IFRCIDKTECDISIFSIDSH 202 IF CI +EC + IF++ H Sbjct: 1661 IFICIFSSECLMKIFALRYH 1680 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 629,793 Number of Sequences: 2352 Number of extensions: 12979 Number of successful extensions: 37 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56768445 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -