BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0646 (550 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0017 + 12297539-12297697,12298191-12298229,12298457-122988... 32 0.35 02_04_0054 + 19279579-19280772 32 0.35 07_03_1567 - 27772815-27773302,27773471-27773561,27773641-277739... 27 9.9 >11_04_0017 + 12297539-12297697,12298191-12298229,12298457-12298825, 12298921-12299058 Length = 234 Score = 31.9 bits (69), Expect = 0.35 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -3 Query: 338 QVPRAGLRRRGGRSEDVQKQGRV*GRVLGETDCYQHRQQKR 216 +VP A ++ GGR D + GR+ G G C RQ K+ Sbjct: 2 EVPAASVKGGGGRRSDEEAPGRIAGNGAGNVACLFTRQGKK 42 >02_04_0054 + 19279579-19280772 Length = 397 Score = 31.9 bits (69), Expect = 0.35 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 2/63 (3%) Frame = -3 Query: 473 RHAGVINVHPFIVLVTQIVGDAFARFPVLIRKHAVALRRLNDDVFQVPRAGL--RRRGGR 300 RH G+ + + T ++ +A+ +L+ KHA L + ++ V RA L RRR R Sbjct: 316 RHPGIFYLSRVLGTQTVVLREAYGGGSLLLAKHAHPLATIREEYSAVMRAALPPRRRRSR 375 Query: 299 SED 291 D Sbjct: 376 ESD 378 >07_03_1567 - 27772815-27773302,27773471-27773561,27773641-27773988, 27774929-27775110,27775191-27775368,27775453-27775605, 27775993-27776232,27776369-27776449,27776485-27776730, 27777151-27777240,27777536-27777778,27778365-27778529, 27779017-27779080,27779162-27779286,27779383-27779476, 27779647-27779714,27779798-27779989,27780618-27780752, 27780847-27780934,27781014-27781107,27781484-27781547, 27781657-27781708,27781911-27782014,27782099-27782158, 27782687-27782770,27782892-27783125,27783442-27783864, 27784675-27784736,27784867-27785521 Length = 1700 Score = 27.1 bits (57), Expect = 9.9 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +1 Query: 31 RLDALRNISIKIPKKKELS 87 RLD L+N S+ +PK+K LS Sbjct: 1493 RLDRLQNTSVNLPKEKVLS 1511 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,178,457 Number of Sequences: 37544 Number of extensions: 284596 Number of successful extensions: 769 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 756 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 769 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1233951264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -