BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0646 (550 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive ... 30 0.058 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 23 8.8 >AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive serine protease-relatedprotein ISPR20 protein. Length = 175 Score = 29.9 bits (64), Expect = 0.058 Identities = 19/63 (30%), Positives = 27/63 (42%) Frame = +3 Query: 360 TESNSVFTDKNGESCKCVPYYLCNKNNEGVDVNNASVTGWGVLDVRFGEEDWQESVEICC 539 T S T GE CV Y C +GV S +G ++D+R +D + + CC Sbjct: 2 TNSEQFCTTSKGEDGICVYQYQCT---DGV----VSHSGANIIDIRHPLDDCNDHLMQCC 54 Query: 540 TNP 548 P Sbjct: 55 AEP 57 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 22.6 bits (46), Expect = 8.8 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 278 LASEHLRNAPHAGEARHGEPGR 343 LAS+H + HAGE G GR Sbjct: 58 LASQHHALSHHAGEPSGGGGGR 79 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 544,819 Number of Sequences: 2352 Number of extensions: 11299 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -