BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0646 (550 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ011021-1|CAB56834.1| 466|Homo sapiens cardiac potassium chann... 30 4.6 AK127482-1|BAC86999.1| 1085|Homo sapiens protein ( Homo sapiens ... 30 6.1 >AJ011021-1|CAB56834.1| 466|Homo sapiens cardiac potassium channel subunit (Kv6.2) protein. Length = 466 Score = 30.3 bits (65), Expect = 4.6 Identities = 14/28 (50%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -2 Query: 327 CRASPAWGAFRRCSEAR-QGLRSCPGRD 247 CR AW A RC AR + LR+C G D Sbjct: 26 CRVRLAWAALARCPLARLERLRACRGHD 53 >AK127482-1|BAC86999.1| 1085|Homo sapiens protein ( Homo sapiens cDNA FLJ45574 fis, clone BRTHA3011187. ). Length = 1085 Score = 29.9 bits (64), Expect = 6.1 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 239 YQHRQQKRTHCASFIKTL*EREHTKFYVTVLRKLCT 132 + +RQ +R H + +K + E+EH + R LCT Sbjct: 868 FPNRQTRRNHLFTMMKNVTEQEHKQSLQLTFRSLCT 903 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,759,035 Number of Sequences: 237096 Number of extensions: 1625705 Number of successful extensions: 7898 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7896 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5421005376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -