BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0646 (550 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL117195-31|CAN99709.1| 1459|Caenorhabditis elegans Hypothetical... 28 3.9 AL117195-30|CAB60772.3| 1456|Caenorhabditis elegans Hypothetical... 28 3.9 AL021474-1|CAA16308.1| 343|Caenorhabditis elegans Hypothetical ... 27 8.9 AF016665-2|AAC71181.1| 662|Caenorhabditis elegans Hypothetical ... 27 8.9 AC024817-39|AAP68916.1| 128|Caenorhabditis elegans Hypothetical... 27 8.9 >AL117195-31|CAN99709.1| 1459|Caenorhabditis elegans Hypothetical protein Y57A10A.18b protein. Length = 1459 Score = 28.3 bits (60), Expect = 3.9 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +3 Query: 36 RRATKHFNKNTQKKGVILILRNQTKKSDN 122 +RAT+ F+KN + + I L+N KK++N Sbjct: 922 KRATEEFDKNLKAQKEIKDLKNSLKKAEN 950 >AL117195-30|CAB60772.3| 1456|Caenorhabditis elegans Hypothetical protein Y57A10A.18a protein. Length = 1456 Score = 28.3 bits (60), Expect = 3.9 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +3 Query: 36 RRATKHFNKNTQKKGVILILRNQTKKSDN 122 +RAT+ F+KN + + I L+N KK++N Sbjct: 922 KRATEEFDKNLKAQKEIKDLKNSLKKAEN 950 >AL021474-1|CAA16308.1| 343|Caenorhabditis elegans Hypothetical protein Y32F6A.1 protein. Length = 343 Score = 27.1 bits (57), Expect = 8.9 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +3 Query: 15 TRVSVKVRRATKHFNKNTQKKGVILILRNQTKK 113 T+VS K+RR +HF + K +I + + K+ Sbjct: 80 TKVSHKIRRLLRHFQDSGSAKKIITLANQKCKE 112 >AF016665-2|AAC71181.1| 662|Caenorhabditis elegans Hypothetical protein C49D10.8 protein. Length = 662 Score = 27.1 bits (57), Expect = 8.9 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -1 Query: 145 ENYALISTLSLFFV*LRKIRITPFFWVFLLKCFVARLT-FTETLVPNS 5 EN +LIS +S F+V R RI P + + +L VA F ET V ++ Sbjct: 59 ENQSLISLVSTFYV-KRFKRILPLYLLVILLSMVALYNFFPETTVESN 105 >AC024817-39|AAP68916.1| 128|Caenorhabditis elegans Hypothetical protein Y54G2A.36 protein. Length = 128 Score = 27.1 bits (57), Expect = 8.9 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 345 CLPGSPCRASPAWGAFRRCSEARQ 274 C+ G PC+ A G F RC Q Sbjct: 53 CVDGWPCQEDSACGGFNRCLHQEQ 76 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,117,874 Number of Sequences: 27780 Number of extensions: 249504 Number of successful extensions: 769 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 769 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1113119490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -