BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0643 (671 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 25 2.9 AJ618923-1|CAF02002.1| 155|Anopheles gambiae odorant-binding pr... 23 6.6 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 24.6 bits (51), Expect = 2.9 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 7 WIPGLQEFGTRNTKSTHVFIFCKF 78 W+P Q G + K H FIF F Sbjct: 439 WLPDGQGMGIPSGKEAHPFIFLPF 462 >AJ618923-1|CAF02002.1| 155|Anopheles gambiae odorant-binding protein OBPjj5c protein. Length = 155 Score = 23.4 bits (48), Expect = 6.6 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +3 Query: 567 LIVPSCGLASIPSAAGLMFLQNQFKVISTDIPDV 668 LI P C IPS+ FLQ F ++ D PD+ Sbjct: 99 LISPQC----IPSS--FRFLQCTFSIVYRDCPDI 126 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 584,300 Number of Sequences: 2352 Number of extensions: 9073 Number of successful extensions: 56 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -