BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0642 (620 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1687.11 |spb1||rRNA methyltransferase Spb1 |Schizosaccharomy... 26 3.8 SPBC25B2.03 |||zf-C3HC4 type zinc finger|Schizosaccharomyces pom... 26 5.1 SPBP35G2.11c |||transcription related zf-ZZ type zinc finger pro... 25 6.7 SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|S... 25 8.8 SPBC14C8.01c |cut2|SPBC1815.02c|securin|Schizosaccharomyces pomb... 25 8.8 SPAPB1A10.10c |ypt71||GTPase Ypt71|Schizosaccharomyces pombe|chr... 25 8.8 >SPAC1687.11 |spb1||rRNA methyltransferase Spb1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 802 Score = 26.2 bits (55), Expect = 3.8 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -1 Query: 581 DVYFVTMTQVIQWVQNPRTVTEAKNFEPWREKCSVEG 471 D F V + VQ P T +AK F P + K S EG Sbjct: 208 DPRFTDPRTVFEEVQEPVTNVDAKVFHPEKRKRSREG 244 >SPBC25B2.03 |||zf-C3HC4 type zinc finger|Schizosaccharomyces pombe|chr 2|||Manual Length = 554 Score = 25.8 bits (54), Expect = 5.1 Identities = 19/74 (25%), Positives = 30/74 (40%) Frame = -3 Query: 597 PSKPQRRLLRYHDTSDPMGTKPTYRD*SQELRAVERKVLRRRKPCMLGTSFLQAHFKGSS 418 P P + + HD + + T + D +L R+ LRR L S L ++ Sbjct: 260 PWPPNQHIKFAHDDKNVVSTDFIHPDWQYKLERARRRALRRAANATLLNSHLLETGPANA 319 Query: 417 RRNHQFTNLFEMPS 376 NH T+L P+ Sbjct: 320 NANHN-TDLSHDPT 332 >SPBP35G2.11c |||transcription related zf-ZZ type zinc finger protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 397 Score = 25.4 bits (53), Expect = 6.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 452 PHSCKLTSKEVPGETINLQTCLRCP 378 P+S +TS PGE +N L+ P Sbjct: 329 PYSFPITSSVHPGEDVNFTVALKVP 353 >SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|Schizosaccharomyces pombe|chr 1|||Manual Length = 2397 Score = 25.0 bits (52), Expect = 8.8 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 5/56 (8%) Frame = -3 Query: 393 LFEMPSQLPXVKRPH-----GRWPLLRSHDLEPHVLY*LILIWCSSCSKYIIVGNV 241 L+ +P +P H G WPL S + E + + I S CSKY+ GNV Sbjct: 1290 LYLLPKIIPVALSLHNAEFQGLWPLRNSSEKEE--VCSVFNISKSVCSKYVQFGNV 1343 >SPBC14C8.01c |cut2|SPBC1815.02c|securin|Schizosaccharomyces pombe|chr 2|||Manual Length = 301 Score = 25.0 bits (52), Expect = 8.8 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 514 PRTSSRGEKSAPSKET-LHAGYLIPASSLQRKFPEKPSIYK 395 P S G+ K+T L + AS QRK EKPS+ K Sbjct: 193 PLLSVDGDSPLTEKDTNLTTPATLKASDQQRKVLEKPSVSK 233 >SPAPB1A10.10c |ypt71||GTPase Ypt71|Schizosaccharomyces pombe|chr 1|||Manual Length = 208 Score = 25.0 bits (52), Expect = 8.8 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 435 HFKGSSRRNHQFTNLFEMPSQL 370 HF+ S++ N T+LFE S+L Sbjct: 154 HFEASAKENTNVTDLFETVSRL 175 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,408,350 Number of Sequences: 5004 Number of extensions: 48702 Number of successful extensions: 112 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 273658928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -