BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0642 (620 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding pr... 26 0.84 AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-b... 26 0.84 AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsiv... 25 1.9 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 25 2.6 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 3.4 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 3.4 >AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding protein AgamOBP24 protein. Length = 176 Score = 26.2 bits (55), Expect = 0.84 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = -1 Query: 491 EKCSVEGNPAC---WVPHSCKLTSKEVPGETINLQ 396 +KCSVEG AC + + C ++ +VP E ++ Sbjct: 132 KKCSVEGTDACDTAYQMYKCFFSNHKVPKELFQMR 166 >AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-binding protein OBPjj10 protein. Length = 207 Score = 26.2 bits (55), Expect = 0.84 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = -1 Query: 491 EKCSVEGNPAC---WVPHSCKLTSKEVPGETINLQ 396 +KCSVEG AC + + C ++ +VP E ++ Sbjct: 163 KKCSVEGTDACDTAYQMYKCFFSNHKVPKELFQMR 197 >AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsive protein 2 protein. Length = 439 Score = 25.0 bits (52), Expect = 1.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -1 Query: 536 NPRTVTEAKNFEPWREKCSVEGNPA 462 NP T+ + F W E C++ NP+ Sbjct: 324 NPGPQTQTEGFYSWAEVCAMLPNPS 348 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 24.6 bits (51), Expect = 2.6 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -3 Query: 618 LVLDRRDPSKPQRRLLRYHDTSDPM 544 L +DP PQ R YH T P+ Sbjct: 1258 LTAQHQDPRGPQGRSTDYHATQQPL 1282 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 24.2 bits (50), Expect = 3.4 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 450 SFLQAHFKGSSRRNHQFTNLFEMPSQ-LPXVKRPHGRWPLLRSHDLE 313 ++L+ S R H F L + Q + ++R GRW L+ D+E Sbjct: 804 TYLKIPKDSSIRAGHDF--LLAIQEQCVTVIERQQGRWKALKPFDIE 848 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 24.2 bits (50), Expect = 3.4 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 450 SFLQAHFKGSSRRNHQFTNLFEMPSQ-LPXVKRPHGRWPLLRSHDLE 313 ++L+ S R H F L + Q + ++R GRW L+ D+E Sbjct: 805 TYLKIPKDSSIRAGHDF--LLAIQEQCVTVIERQQGRWKALKPFDIE 849 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 598,676 Number of Sequences: 2352 Number of extensions: 12127 Number of successful extensions: 18 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60214320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -