BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0642 (620 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-... 22 5.5 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 22 5.5 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 7.3 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 7.3 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 21 7.3 S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor prot... 21 9.7 >M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H40. ). Length = 74 Score = 21.8 bits (44), Expect = 5.5 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 569 VTMTQVIQWVQNPRTVTEAKN 507 +T TQV W QN RT + +N Sbjct: 47 LTETQVKIWFQNRRTKWKKQN 67 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 233 ALVTLPTIMYF 265 AL+TLPTI +F Sbjct: 327 ALITLPTIFWF 337 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.4 bits (43), Expect = 7.3 Identities = 6/22 (27%), Positives = 15/22 (68%) Frame = -3 Query: 285 IWCSSCSKYIIVGNVTKAILSD 220 +W SSCS ++ + + A++++ Sbjct: 278 VWMSSCSVFVFLSLMEFAVVNN 299 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 260 YFEQLLHQININ 295 YFEQ L+++N N Sbjct: 48 YFEQTLNELNFN 59 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.4 bits (43), Expect = 7.3 Identities = 15/52 (28%), Positives = 20/52 (38%) Frame = -3 Query: 609 DRRDPSKPQRRLLRYHDTSDPMGTKPTYRD*SQELRAVERKVLRRRKPCMLG 454 D R K + LLR D+ D + TY A V + C+LG Sbjct: 63 DGRVGGKRRNILLRRTDSMDSQNSASTYNSFLSSDSASSGNVYCKCDDCLLG 114 >S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor protein. Length = 85 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -3 Query: 135 GSHEYLIGLFY 103 GSH ++GLFY Sbjct: 54 GSHIIIVGLFY 64 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,343 Number of Sequences: 438 Number of extensions: 3262 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18460203 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -