BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0641 (618 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP35G2.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 28 1.2 SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gc... 25 6.6 SPAC17A2.09c |csx1||RNA-binding protein Csx1|Schizosaccharomyces... 25 8.8 SPAC1093.01 ||SPAC12B10.18|PPR repeat protein|Schizosaccharomyce... 25 8.8 >SPBP35G2.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 1060 Score = 27.9 bits (59), Expect = 1.2 Identities = 14/51 (27%), Positives = 19/51 (37%) Frame = +1 Query: 220 KKKMACATLKRNLDWESKAQLPTKRRRCSPFAASPSTSPGLKTSESKPSSF 372 + + T L W + PT PF P+TS L + SSF Sbjct: 244 RARQTTRTRSNTLPWSPRVFGPTLGYNTPPFGYPPTTSSALPNASGSSSSF 294 >SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gcn2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1576 Score = 25.4 bits (53), Expect = 6.6 Identities = 7/31 (22%), Positives = 19/31 (61%) Frame = +3 Query: 291 EKKMFTICSKSKHKSWVKNIRIETIFIWRIR 383 +KK+ T+ + K + W+ + R I+++ ++ Sbjct: 1546 QKKLVTLAEQDKKRVWICSFRTNEIYLYGLK 1576 >SPAC17A2.09c |csx1||RNA-binding protein Csx1|Schizosaccharomyces pombe|chr 1|||Manual Length = 632 Score = 25.0 bits (52), Expect = 8.8 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = +1 Query: 265 ESKAQL--PTKRRRCSPFAASPSTSP 336 E K++L PT R +PF SPS++P Sbjct: 47 EGKSELVSPTLERLVAPFNCSPSSTP 72 >SPAC1093.01 ||SPAC12B10.18|PPR repeat protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1261 Score = 25.0 bits (52), Expect = 8.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 349 SESKPSSFGESVSAPVKITPERMAQEIYDEIKR 447 S +PS++ V A + + R A EI +++KR Sbjct: 1177 SGKEPSTYENMVRAYLSVNDGRKAMEIVEQLKR 1209 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,633,724 Number of Sequences: 5004 Number of extensions: 54334 Number of successful extensions: 162 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 271646730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -