BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0638 (623 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive ... 54 3e-09 AF203337-1|AAF19832.1| 184|Anopheles gambiae immune-responsive ... 47 4e-07 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 28 0.28 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 26 0.85 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 26 0.85 AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease pr... 26 1.1 AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14... 25 1.5 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 25 2.6 DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domai... 23 6.0 DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosylt... 23 6.0 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 6.0 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 6.0 AJ007394-1|CAA07489.1| 112|Anopheles gambiae mucin protein. 23 6.0 AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. 23 6.0 AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. 23 7.9 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 23 7.9 AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram nega... 23 7.9 AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram nega... 23 7.9 >AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive serine protease-relatedprotein ISPR20 protein. Length = 175 Score = 54.4 bits (125), Expect = 3e-09 Identities = 26/69 (37%), Positives = 35/69 (50%) Frame = +2 Query: 308 STNDDLSCQTSDGQEGECVNYYLCNAANNTIITDGTNVIDIRVGSGPCSSYIDVCCLAPD 487 STN + C TS G++G CV Y C + + G N+IDIR C+ ++ CC P Sbjct: 1 STNSEQFCTTSKGEDGICVYQYQCT--DGVVSHSGANIIDIRHPLDDCNDHLMQCCAEPK 58 Query: 488 QRPPTDPIT 514 Q PIT Sbjct: 59 QATTIPPIT 67 Score = 29.9 bits (64), Expect = 0.069 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 542 QGCGWRNPDGVAFRTTGDVDGETKFGE 622 +GCG RNP G+ F + E+++GE Sbjct: 114 EGCGHRNPHGMIFTIENNQFSESEYGE 140 >AF203337-1|AAF19832.1| 184|Anopheles gambiae immune-responsive serine protease-relatedprotein ISPR9 protein. Length = 184 Score = 47.2 bits (107), Expect = 4e-07 Identities = 20/36 (55%), Positives = 26/36 (72%) Frame = +2 Query: 515 PRPETLPMNQGCGWRNPDGVAFRTTGDVDGETKFGE 622 P +T+ + Q CG RN DGV FR TGD DGE+++GE Sbjct: 40 PLDKTVSVPQKCGLRNVDGVGFRITGDNDGESEYGE 75 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 27.9 bits (59), Expect = 0.28 Identities = 25/98 (25%), Positives = 37/98 (37%), Gaps = 5/98 (5%) Frame = +2 Query: 326 SCQTSDGQEGECVNYYLCNAANNTII-----TDGTNVIDIRVGSGPCSSYIDVCCLAPDQ 490 +C+T DG+ G CV C + N ++ T + ++ G + VCC P Sbjct: 31 ACETPDGKVGTCVYLRSCLSIRNVLLKKENMTPEDRSLVMKSKCGQEGRSVLVCC--PLV 88 Query: 491 RPPTDPITPRPETLPMNQGCGWRNPDGVAFRTTGDVDG 604 R T P LP CG D + +DG Sbjct: 89 RKLTGRF-DAPVELPPPGECGKMQMDRIVGGEVAPIDG 125 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 26.2 bits (55), Expect = 0.85 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +2 Query: 224 SAKPPTQLQPVTQPSVADRAPSTLVPGVSTNDDLSCQTSDGQEG 355 +AKP + P PS S+ G+ ++DD +TS ++G Sbjct: 414 TAKPTPKPIPKPAPSSETNGSSSQERGMESSDDAKSETSSTKDG 457 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 26.2 bits (55), Expect = 0.85 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +2 Query: 224 SAKPPTQLQPVTQPSVADRAPSTLVPGVSTNDDLSCQTSDGQEG 355 +AKP + P PS S+ G+ ++DD +TS ++G Sbjct: 414 TAKPTPKPIPKPAPSSETNGSSSQERGMESSDDAKSETSSTKDG 457 >AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease protein. Length = 435 Score = 25.8 bits (54), Expect = 1.1 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +2 Query: 302 GVSTNDDLSCQTSDGQEGECVNYYLC 379 G S+ C+T G++G C Y C Sbjct: 93 GKSSTKGKECRTRAGEKGHCTRYQSC 118 >AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14A protein. Length = 365 Score = 25.4 bits (53), Expect = 1.5 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 452 SSYIDVCCLAPDQRPPTDP 508 ++++ CL PD PPT P Sbjct: 236 NNFVSPVCLPPDDFPPTSP 254 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 24.6 bits (51), Expect = 2.6 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = +2 Query: 482 PDQRPPTDPITPRPETLPMNQGCGWRNPDGV 574 P RPP PRP+ P N P G+ Sbjct: 264 PPIRPPNPMGGPRPQISPQNSNLSGGMPSGM 294 >DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 23.4 bits (48), Expect = 6.0 Identities = 14/42 (33%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = -3 Query: 345 PSEVWHERSSFVET---PGTRVDGALSATLGCVTGCNCVGGF 229 P EV++E S + R L+ T CV GC C G+ Sbjct: 61 PREVYNECGSSCDDRTCENIRRGDHLACTKHCVEGCFCRNGY 102 >DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosyltransferase 2 protein. Length = 451 Score = 23.4 bits (48), Expect = 6.0 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -2 Query: 589 RGPEGNAVRVPPAAALVHWQGLRPGRDGICW 497 RG + +PP ++LVHW+ + + W Sbjct: 86 RGYRRTRLVLPPWSSLVHWRSGNIDQQQLLW 116 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.4 bits (48), Expect = 6.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +2 Query: 476 LAPDQRPPTDPITPRPETLP 535 L + PP P++PRP P Sbjct: 691 LLTESAPPIAPMSPRPNRFP 710 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 221 TSAKPPTQLQPVTQPSVADRAPSTLVP 301 T A+ LQP T+PS+ PS + P Sbjct: 1150 TIAETDEYLQPKTRPSIMLPGPSAVEP 1176 >AJ007394-1|CAA07489.1| 112|Anopheles gambiae mucin protein. Length = 112 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 221 TSAKPPTQLQPVTQPSVADRAPSTLVPGVST 313 T A T + P T +VA +T+ PG +T Sbjct: 35 TVAPTTTTVAPTTTTTVAPTTTTTVAPGQTT 65 >AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. Length = 122 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 221 TSAKPPTQLQPVTQPSVADRAPSTLVPGVST 313 T A T + P T +VA +T+ PG +T Sbjct: 35 TVAPTTTTVAPTTTTTVAPTTTTTVAPGQTT 65 >AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. Length = 438 Score = 23.0 bits (47), Expect = 7.9 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 517 GRDGICWRSLVGSQTADVDV 458 GR G+ WR+ +G+Q V + Sbjct: 129 GRFGVVWRAQLGNQEVAVKI 148 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 23.0 bits (47), Expect = 7.9 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 284 PSTLVPGVSTNDDLSCQTSDGQEGEC 361 P TLV STND LS G C Sbjct: 840 PRTLVANDSTNDLLSHNKVSSLHGSC 865 >AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -3 Query: 360 HSPSWPSEVWHERSSFVETPGTRVDGALSATL 265 +SP ++ W+ R+ ++ T DG SA+L Sbjct: 354 NSPQAATDFWNGRAQWLPTWNLERDGGKSASL 385 >AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -3 Query: 360 HSPSWPSEVWHERSSFVETPGTRVDGALSATL 265 +SP ++ W+ R+ ++ T DG SA+L Sbjct: 354 NSPQAATDFWNGRAQWLPTWNLERDGGKSASL 385 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 636,848 Number of Sequences: 2352 Number of extensions: 12007 Number of successful extensions: 52 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -