BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0638 (623 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g75620.1 68414.m08786 glyoxal oxidase-related contains simila... 32 0.36 At1g19900.1 68414.m02495 glyoxal oxidase-related contains simila... 32 0.36 At4g19830.1 68417.m02907 immunophilin / FKBP-type peptidyl-proly... 30 1.4 At3g09000.1 68416.m01053 proline-rich family protein 30 1.4 At2g37810.1 68415.m04642 CHP-rich zinc finger protein, putative 29 2.5 At5g47460.1 68418.m05861 pentatricopeptide (PPR) repeat-containi... 28 4.4 At3g58600.1 68416.m06531 expressed protein hypothetical protein ... 28 4.4 At3g54320.1 68416.m06003 ovule development protein, putative sim... 28 5.8 At5g19340.1 68418.m02305 expressed protein 27 7.7 >At1g75620.1 68414.m08786 glyoxal oxidase-related contains similarity to glyoxal oxidase precursor [Phanerochaete chrysosporium] gi|1050302|gb|AAA87594 Length = 547 Score = 31.9 bits (69), Expect = 0.36 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = +2 Query: 518 RPETLPMNQGC--GWRNPDGVAFRTTGDVDGETK 613 RP T+ N C G PDG +T GD+DGE K Sbjct: 107 RPLTVQSNTWCSSGGVTPDGTLLQTGGDLDGERK 140 >At1g19900.1 68414.m02495 glyoxal oxidase-related contains similarity to glyoxal oxidase precursor [Phanerochaete chrysosporium] gi|1050302|gb|AAA87594 Length = 548 Score = 31.9 bits (69), Expect = 0.36 Identities = 18/36 (50%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +2 Query: 512 TPRPETLPMNQGC--GWRNPDGVAFRTTGDVDGETK 613 T RP T+ N C G PDGV +T GD DGE K Sbjct: 101 TIRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELK 136 >At4g19830.1 68417.m02907 immunophilin / FKBP-type peptidyl-prolyl cis-trans isomerase family protein similar to 70 kDa peptidylprolyl isomerase (Peptidylprolyl cis-trans isomerase) (PPiase) (Rotamase) (SP:Q43207) [Triticum aestivum]; FKBP-type peptidyl-prolyl cis-trans isomerase,Synechocystis sp., PIR2:S75144; contains Pfam PF00254: peptidyl-prolyl cis-trans isomerase, FKBP-type Length = 229 Score = 29.9 bits (64), Expect = 1.4 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +3 Query: 306 SLRTMTFRARPPTAKKGSASTITCAMRPITPLSLTEQTSSI 428 SLR R+ P++ S+ST+ A R LS+ TSS+ Sbjct: 26 SLRIFASRSSAPSSSSSSSSTVAAASRRSISLSIIAVTSSV 66 >At3g09000.1 68416.m01053 proline-rich family protein Length = 541 Score = 29.9 bits (64), Expect = 1.4 Identities = 28/93 (30%), Positives = 40/93 (43%), Gaps = 6/93 (6%) Frame = +3 Query: 270 SLIGLHRPWCLASLRTMTFRARPPTAKKGSASTITCAMRPITPLSLTEQTSSI*ESAVAR 449 S+ GL RP S R+ + RP T + S + T RP+T + ++S+ A Sbjct: 140 SVAGLRRPSSSGSSRSTS---RPATPTRRSTTPTTSTSRPVTTRASNSRSSTPTSRATLT 196 Query: 450 VHR--TSTSAVWLPTRD----RQQIPSRPGRRP 530 R TST+A T R P+R RP Sbjct: 197 AARATTSTAAPRTTTTSSGSARSATPTRSNPRP 229 >At2g37810.1 68415.m04642 CHP-rich zinc finger protein, putative Length = 233 Score = 29.1 bits (62), Expect = 2.5 Identities = 17/62 (27%), Positives = 26/62 (41%), Gaps = 3/62 (4%) Frame = +2 Query: 377 CNAANNTIITDGTNVIDIRVGSGPCSSYIDVCCL---APDQRPPTDPITPRPETLPMNQG 547 C A+N ++ G ++ R GPC + V C+ AP P + + P N Sbjct: 131 CGASNTCMVCRGA-ILSWRYKCGPCMLDVHVECVNSSAPAATEPQMDLNTSQDPQPYNDE 189 Query: 548 CG 553 CG Sbjct: 190 CG 191 >At5g47460.1 68418.m05861 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 576 Score = 28.3 bits (60), Expect = 4.4 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -2 Query: 517 GRDGICWRSLVGSQTADVDVR*TRATADSYID 422 G DG+ WR+L+G+ +A D++ + A I+ Sbjct: 488 GYDGVAWRALLGACSARKDLKAAKTVAAKMIE 519 >At3g58600.1 68416.m06531 expressed protein hypothetical protein F21M11.17 - Arabidopsis thaliana, EMBL:AC003027 Length = 302 Score = 28.3 bits (60), Expect = 4.4 Identities = 18/55 (32%), Positives = 25/55 (45%) Frame = +2 Query: 194 LESIINQIFTSAKPPTQLQPVTQPSVADRAPSTLVPGVSTNDDLSCQTSDGQEGE 358 +E+ I I PP L PVT A ++PS+L P +S Q D + E Sbjct: 220 IETTIPSIILPPPPPGPLSPVT---TAQKSPSSLPPSLSLQRSSEQQDLDTKREE 271 >At3g54320.1 68416.m06003 ovule development protein, putative similar to ovule development protein aintegumenta (GI:1209099) [Arabidopsis thaliana] Length = 427 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = +3 Query: 351 KGSASTITCAMRPITPLSLTEQTSSI*ESAVARVHRTSTSAVWLPTRDRQQIPSRP 518 K +T TC+ P + +S + TSS +S R R + P+ D+ P+ P Sbjct: 2 KKRLTTSTCSSSPSSSVSSSTTTSSPIQSEAPRPKRAKRAKKSSPSGDKSHNPTSP 57 >At5g19340.1 68418.m02305 expressed protein Length = 263 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +2 Query: 266 SVADRAPSTLVPGVSTNDDLSCQTSDGQEGECVN 367 ++A+ PST P +S + DLS SDG + C+N Sbjct: 8 TMAEAEPSTTGPRISFSADLSSSDSDG-DFICIN 40 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,131,446 Number of Sequences: 28952 Number of extensions: 259378 Number of successful extensions: 857 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 806 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 856 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -