BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0635 (533 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochr... 22 3.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.0 >AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 124 Score = 22.2 bits (45), Expect = 3.0 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 143 TFGIPFYARFKHNEPFEAVKDRLQKKLDIPDKEWEKYNFAVV 268 TF F HNE + ++ +P+ + +++N+A V Sbjct: 83 TFLSLFIYGMHHNEKYFPEPEKFDPNRYLPENQAKRHNYAYV 124 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 9.0 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 478 RRAATGSVVYFDGLLQVVDAGSLRRLVDVLEP 383 ++ A+ F L+QVV LRR D +P Sbjct: 767 KKGASSDKPNFTKLIQVVPTMELRREFDKQKP 798 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,889 Number of Sequences: 336 Number of extensions: 2205 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12992348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -