BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0630 (592 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 29 0.11 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 27 0.34 AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 27 0.45 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 27 0.60 AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 26 0.79 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 25 1.4 AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CY... 25 1.4 AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 25 1.8 AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CY... 25 1.8 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 25 2.4 AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CY... 24 3.2 AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 24 3.2 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 24 3.2 AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CY... 24 4.2 AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CY... 24 4.2 AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CY... 24 4.2 AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CY... 24 4.2 AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CY... 24 4.2 AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CY... 24 4.2 AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 24 4.2 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 24 4.2 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 23 5.6 AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 23 5.6 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 23 5.6 AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 23 7.4 AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 pr... 23 7.4 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 9.8 AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 23 9.8 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 29.1 bits (62), Expect = 0.11 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = +2 Query: 419 LSSHVYIDKAEEYRFFKPWLGNGLLISTGQKWRSHRKLIAP-TFHLNVLKSFID 577 + S VY K +FK + GLL G+ W R ++ P V++ ++D Sbjct: 121 MDSFVYYRKQHRPEYFKGY--GGLLAEQGEDWHKMRTIVNPIMMQPKVIRQYVD 172 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 27.5 bits (58), Expect = 0.34 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +2 Query: 503 GQKWRSHRKLIAPTFHLNVLK 565 GQKWRS R ++PTF +K Sbjct: 125 GQKWRSLRNKLSPTFTSGKMK 145 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 27.1 bits (57), Expect = 0.45 Identities = 16/69 (23%), Positives = 34/69 (49%), Gaps = 2/69 (2%) Frame = +2 Query: 380 LVFLYDPRDVEVILSS--HVYIDKAEEYRFFKPWLGNGLLISTGQKWRSHRKLIAPTFHL 553 L++++D + ++ +L H + ++ + L + GQKWR+ R ++PTF Sbjct: 81 LLYIFDTKLIKQLLVKDFHHFPNRGVYFNERDDPLSAHMFAIEGQKWRTLRAKLSPTFTS 140 Query: 554 NVLKSFIDL 580 +K + L Sbjct: 141 GRIKMTLPL 149 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 26.6 bits (56), Expect = 0.60 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +2 Query: 500 TGQKWRSHRKLIAPTF 547 TGQ+WR+ R ++PTF Sbjct: 129 TGQRWRNVRTTLSPTF 144 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 26.2 bits (55), Expect = 0.79 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 Query: 464 FKPWLGNGLLISTGQKWRSHRKLIAPTFHLNVLKS 568 F P N L G KWR R + PTF LK+ Sbjct: 112 FDPLSAN-LFFMEGAKWRKLRSKLTPTFTSGKLKA 145 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 25.4 bits (53), Expect = 1.4 Identities = 20/74 (27%), Positives = 30/74 (40%) Frame = +2 Query: 359 IWIGPRLLVFLYDPRDVEVILSSHVYIDKAEEYRFFKPWLGNGLLISTGQKWRSHRKLIA 538 I++ P LLV +I H + D+ + L L GQ+W+ R I Sbjct: 84 IFLNPVLLVTDLKLAKRILIEDFHHFPDRGVYFNEKDDPLSAHLFAIEGQRWKDLRAKIT 143 Query: 539 PTFHLNVLKSFIDL 580 PTF +K+ L Sbjct: 144 PTFTSGRMKAAFPL 157 >AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CYP6M1 protein. Length = 503 Score = 25.4 bits (53), Expect = 1.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 503 GQKWRSHRKLIAPTFHLNVLK 565 GQKWR+ R + PTF +K Sbjct: 126 GQKWRNLRNKMTPTFTSGKMK 146 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 25.0 bits (52), Expect = 1.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 503 GQKWRSHRKLIAPTFHLNVLK 565 GQKW++ R ++PTF +K Sbjct: 65 GQKWKNLRNKLSPTFTSGKMK 85 >AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CYP6Z1 protein. Length = 494 Score = 25.0 bits (52), Expect = 1.8 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +2 Query: 503 GQKWRSHRKLIAPTFHLNVLKSFIDLFNA 589 GQ+W++ R + PTF L+ + F A Sbjct: 119 GQRWKNLRAKLTPTFTSGQLRHMLPTFLA 147 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 24.6 bits (51), Expect = 2.4 Identities = 22/93 (23%), Positives = 38/93 (40%), Gaps = 11/93 (11%) Frame = +2 Query: 332 DYDHESVVKIWIGPRLLVFLYDPRDVEVILSSHVY------IDKAEEYR-FFKPWLGN-- 484 DY K G R ++ Y P D+E + + D YR +P + + Sbjct: 83 DYGDIVRFKGMFGRRDIIMTYSPSDIEKVFRNEGQWPIRRGFDSFTYYRTHVRPDIFSET 142 Query: 485 -GLLISTGQKWRSHRKLIAPT-FHLNVLKSFID 577 GL+ G+KW+ R ++ P +K ++D Sbjct: 143 GGLVTEHGEKWQKVRTIVNPVMMQPKTIKLYVD 175 >AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CYP6M4 protein. Length = 424 Score = 24.2 bits (50), Expect = 3.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 503 GQKWRSHRKLIAPTFHLNVLK 565 G KW+S R I PTF +K Sbjct: 65 GYKWKSLRNKITPTFTSGKMK 85 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 24.2 bits (50), Expect = 3.2 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +2 Query: 470 PWLGNGLLISTGQKWRSHRKLIAPTFHLNVLKSFI 574 P+ N L GQ+W++ R + PTF L++ + Sbjct: 109 PFSAN-LFALPGQRWKNLRAKLTPTFTSGQLRNML 142 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 24.2 bits (50), Expect = 3.2 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +2 Query: 470 PWLGNGLLISTGQKWRSHRKLIAPTFHLNVLKSFI 574 P+ N L GQ+W++ R + PTF L++ + Sbjct: 109 PFSAN-LFALPGQRWKNLRAKLTPTFTSGQLRNML 142 >AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.8 bits (49), Expect = 4.2 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +2 Query: 470 PWLGNGLLISTGQKWRSHRKLIAPTF 547 P G L +WR+ R +++P F Sbjct: 2 PLFGRALFAMRDTRWRNMRTILSPAF 27 >AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.8 bits (49), Expect = 4.2 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +2 Query: 470 PWLGNGLLISTGQKWRSHRKLIAPTF 547 P G L +WR+ R +++P F Sbjct: 2 PLFGRALFAMRDTRWRNMRTILSPAF 27 >AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.8 bits (49), Expect = 4.2 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +2 Query: 470 PWLGNGLLISTGQKWRSHRKLIAPTF 547 P G L +WR+ R +++P F Sbjct: 2 PLFGRALFAMRDTRWRNMRTILSPAF 27 >AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.8 bits (49), Expect = 4.2 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +2 Query: 470 PWLGNGLLISTGQKWRSHRKLIAPTF 547 P G L +WR+ R +++P F Sbjct: 2 PLFGRALFAMRDTRWRNMRTILSPAF 27 >AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.8 bits (49), Expect = 4.2 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +2 Query: 470 PWLGNGLLISTGQKWRSHRKLIAPTF 547 P G L +WR+ R +++P F Sbjct: 2 PLFGRALFAMRDTRWRNMRTILSPAF 27 >AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.8 bits (49), Expect = 4.2 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +2 Query: 470 PWLGNGLLISTGQKWRSHRKLIAPTF 547 P G L +WR+ R +++P F Sbjct: 2 PLFGRALFAMRDTRWRNMRTILSPAF 27 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 23.8 bits (49), Expect = 4.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 476 LGNGLLISTGQKWRSHRKLIAPTF 547 L L G +WR+ R+ + PTF Sbjct: 118 LSGNLFALEGHEWRALRQKLTPTF 141 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 23.8 bits (49), Expect = 4.2 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +2 Query: 470 PWLGNGLLISTGQKWRSHRKLIAPTF 547 P G L +WR+ R +++P F Sbjct: 122 PLFGRALFAMRDTRWRNMRTILSPAF 147 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 23.4 bits (48), Expect = 5.6 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +2 Query: 476 LGNGLLISTGQKWRSHRKLIAPTFHLNVLK 565 L L G++WR R ++PTF +K Sbjct: 117 LSGHLFALDGERWRYLRNKLSPTFTSGKIK 146 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 23.4 bits (48), Expect = 5.6 Identities = 17/73 (23%), Positives = 32/73 (43%), Gaps = 2/73 (2%) Frame = +2 Query: 353 VKIWIGPRLLVFLYDPRDVEVILSSHV--YIDKAEEYRFFKPWLGNGLLISTGQKWRSHR 526 + +I P + L DP ++ +L + D+ Y L + L+ G +W++ R Sbjct: 71 IHFFINP--VALLIDPDLIKTVLVKDFSYFHDRNLYYNERDDPLSHHLVAMEGTRWKNLR 128 Query: 527 KLIAPTFHLNVLK 565 + PTF +K Sbjct: 129 AKLTPTFTSGKMK 141 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.4 bits (48), Expect = 5.6 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +2 Query: 476 LGNGLLISTGQKWRSHRKLIAPTFHLNVLKS 568 L L G +W R +APTF LK+ Sbjct: 115 LSANLFFLEGNRWGKLRSKLAPTFTSGKLKA 145 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 23.0 bits (47), Expect = 7.4 Identities = 8/37 (21%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 482 NGLLISTGQKWRSHRKLIAPT-FHLNVLKSFIDLFNA 589 +GL+ + G+ W+ R ++ P +++ ++D +A Sbjct: 140 SGLITTQGETWQQLRTIVNPVMMQPKIIRLYVDQVDA 176 >AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 503 GQKWRSHRKLIAPTFHLNVLK 565 G KW + RK + PTF +K Sbjct: 121 GTKWTNLRKKLIPTFSSGKMK 141 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 22.6 bits (46), Expect = 9.8 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 374 RLLVFLYDPRDVEVILSSHVY 436 R +LYDP+DV++ + V+ Sbjct: 1225 RKTAYLYDPQDVQLSVDGIVF 1245 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 22.6 bits (46), Expect = 9.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 503 GQKWRSHRKLIAPTF 547 GQ WR R+ + PTF Sbjct: 127 GQPWRLMRQKLTPTF 141 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 584,525 Number of Sequences: 2352 Number of extensions: 11424 Number of successful extensions: 48 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56768445 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -