BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0628 (532 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-... 21 6.8 AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-... 21 6.8 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 21 8.9 >AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-like protein protein. Length = 143 Score = 21.0 bits (42), Expect = 6.8 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +3 Query: 300 FTPTFHILKANKII 341 + P FH+++AN I+ Sbjct: 107 YQPRFHLVRANDIL 120 >AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-like protein protein. Length = 134 Score = 21.0 bits (42), Expect = 6.8 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +3 Query: 300 FTPTFHILKANKII 341 + P FH+++AN I+ Sbjct: 98 YQPRFHLVRANDIL 111 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 20.6 bits (41), Expect = 8.9 Identities = 8/37 (21%), Positives = 16/37 (43%) Frame = +3 Query: 207 IKCILFVYN*MHLSLVNSVYSLKIVKQKRLVFTPTFH 317 I+C HL V ++ K +++V+ +H Sbjct: 165 IRCAFLERENCHLKFVTDTLKKELEKLQKIVYLRDYH 201 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,744 Number of Sequences: 336 Number of extensions: 1887 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12887571 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -