BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0628 (532 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52939| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_6457| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_245| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_9580| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 >SB_52939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 5/34 (14%) Frame = +2 Query: 176 FIKYLKRIKIN-----KMYIICI*LNAFVTCKFG 262 F+ + K +K+N KMY++C L +TC +G Sbjct: 89 FLDFKKNLKLNLSCVGKMYLVCAFLENVITCLYG 122 >SB_6457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 5/34 (14%) Frame = +2 Query: 176 FIKYLKRIKIN-----KMYIICI*LNAFVTCKFG 262 F+ + K +K+N KMY++C L +TC +G Sbjct: 85 FLDFKKNLKLNLSCVGKMYLVCAFLENVITCLYG 118 >SB_245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 5/34 (14%) Frame = +2 Query: 176 FIKYLKRIKIN-----KMYIICI*LNAFVTCKFG 262 F+ + K +K+N KMY++C L +TC +G Sbjct: 90 FLDFKKNLKLNLNCVGKMYLVCAFLENVITCLYG 123 >SB_9580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 5/34 (14%) Frame = +2 Query: 176 FIKYLKRIKIN-----KMYIICI*LNAFVTCKFG 262 F+ + K +K+N KMY++C L TC +G Sbjct: 373 FLDFKKNLKVNLSCVGKMYLVCAFLENVTTCLYG 406 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,484,561 Number of Sequences: 59808 Number of extensions: 184358 Number of successful extensions: 361 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 354 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 361 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1191330434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -