BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0626 (590 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 5.6 AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine... 23 5.6 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 5.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = -1 Query: 236 NSIILSVLEANRTPRVMNLSLIKCFVS*IC*HCIYKVIFIFLI 108 N L V+ P + LI CFVS C C +FI I Sbjct: 14 NLYFLFVVRGTGKPFLPTSFLIYCFVSPSCLECSSVPLFINFI 56 >AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine protease protein. Length = 405 Score = 23.4 bits (48), Expect = 5.6 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -1 Query: 512 KLRYPFPGDFVSKSYCGATFRTWS 441 KL+ P +V + C TFR WS Sbjct: 309 KLKLSLP--YVEREKCSKTFRPWS 330 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 634,340 Number of Sequences: 2352 Number of extensions: 13264 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56768445 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -