BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0622 (570 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25798| Best HMM Match : FA_desaturase (HMM E-Value=0) 129 2e-30 SB_6574| Best HMM Match : eIF-6 (HMM E-Value=1.60028e-42) 28 6.2 >SB_25798| Best HMM Match : FA_desaturase (HMM E-Value=0) Length = 268 Score = 129 bits (311), Expect = 2e-30 Identities = 50/77 (64%), Positives = 64/77 (83%) Frame = +3 Query: 339 FGITAGAHRLWSHNGYKVKLPLEILLMVFNSIAFQNTIFTWVRDHRLHHKYTDTDADPHN 518 +G+T GAHRLW+H +K K PL +++M+ NS+A QN IF W RDHR+HHKY++TDADPHN Sbjct: 18 YGVTIGAHRLWAHRTFKAKWPLRLVIMLMNSMAAQNDIFEWSRDHRVHHKYSETDADPHN 77 Query: 519 ATRGFFFSHIGWLLVRK 569 A RGFFFSH+GWL+ RK Sbjct: 78 AKRGFFFSHVGWLMQRK 94 >SB_6574| Best HMM Match : eIF-6 (HMM E-Value=1.60028e-42) Length = 618 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 219 MNVIPFSYLHIAGLYGLYLCFTSAKLATSVFAI 317 MN F YL++ G+ GL+ F +A ++ VF + Sbjct: 284 MNGKKFKYLYVTGVAGLFWGFLAAAVSCCVFYV 316 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,659,629 Number of Sequences: 59808 Number of extensions: 327204 Number of successful extensions: 639 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 612 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 639 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1349364063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -