BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0620 (403 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 26 0.18 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 24 0.56 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 24 0.56 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 4.0 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 21 4.0 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 6.9 DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. 20 9.2 AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. 20 9.2 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 25.8 bits (54), Expect = 0.18 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +2 Query: 44 LIDLVKPYAHLYDVKDPSRKNILARETTWQEIAKQISRPVEE 169 L DLV+ L+D K+ I + Q + I PVEE Sbjct: 132 LCDLVQGLERLFDEKNAGNNKITMKSKKEQNAEEDIVDPVEE 173 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 24.2 bits (50), Expect = 0.56 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 388 VITSCSVFGFCSLXLITFFCLXMS 317 ++ S +V GFC L L+ F C+ +S Sbjct: 444 LLDSYAVSGFCLLFLMFFECIAIS 467 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 24.2 bits (50), Expect = 0.56 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 388 VITSCSVFGFCSLXLITFFCLXMS 317 ++ S +V GFC L L+ F C+ +S Sbjct: 497 LLDSYAVSGFCLLFLMFFECIAIS 520 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 4.0 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -1 Query: 160 WSGYLFRYFLPCC 122 +S YL + ++PCC Sbjct: 241 FSYYLIQIYIPCC 253 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 4.0 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -1 Query: 160 WSGYLFRYFLPCC 122 +S YL + ++PCC Sbjct: 241 FSYYLIQIYIPCC 253 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 20.6 bits (41), Expect = 6.9 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -3 Query: 239 HTTRDVYFXW 210 HTT+D+ F W Sbjct: 155 HTTQDLVFIW 164 >DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. Length = 160 Score = 20.2 bits (40), Expect = 9.2 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 73 FVRRKRPLQEEYTSKGN 123 F++ + LQEE S+GN Sbjct: 51 FIKMQELLQEEDISEGN 67 >AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. Length = 148 Score = 20.2 bits (40), Expect = 9.2 Identities = 6/17 (35%), Positives = 10/17 (58%) Frame = -3 Query: 218 FXWYNYPPETSSISSCI 168 F W +Y PE ++S + Sbjct: 35 FGWGSYGPEAGNVSCSV 51 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,813 Number of Sequences: 438 Number of extensions: 1753 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10008927 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -