BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0613 (583 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36536| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_27983| Best HMM Match : PAN (HMM E-Value=0.0022) 27 8.5 >SB_36536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 27.9 bits (59), Expect = 6.4 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -2 Query: 168 LTPSTTNKTQTLNSMVILNKHASCIIKSEQP 76 L P T +Q LN +V+ ++HA +SE+P Sbjct: 213 LEPETEELSQKLNDVVLASEHAGSESESEKP 243 >SB_27983| Best HMM Match : PAN (HMM E-Value=0.0022) Length = 616 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/25 (44%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = +2 Query: 257 IVFQRV-ITKSVTKSINLLCTWIII 328 +++QRV + K+V + NL+CTW I+ Sbjct: 248 VLYQRVEVCKNVLVTGNLICTWAIL 272 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,613,826 Number of Sequences: 59808 Number of extensions: 252816 Number of successful extensions: 489 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 440 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 478 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1397989795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -