BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0613 (583 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g68750.1 68414.m07859 phosphoenolpyruvate carboxylase family ... 28 4.0 >At1g68750.1 68414.m07859 phosphoenolpyruvate carboxylase family protein / PEP carboxylase family protein similar to SP|P51059 Phosphoenolpyruvate carboxylase 2 (EC 4.1.1.31) (PEPCASE) {Zea mays}; contains Pfam profile PF00311: phosphoenolpyruvate carboxylase Length = 1032 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 275 ITKSVTKSINLLCTWIIIDLSLESFFEFDGLKY 373 +T VTK ++LL W+ IDL + E D L++ Sbjct: 275 VTAKVTKEVSLLSRWMAIDLYIR---EVDSLRF 304 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,058,252 Number of Sequences: 28952 Number of extensions: 168053 Number of successful extensions: 323 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 319 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 323 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1141585696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -