BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0609 (517 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC736.05 |wtf7||wtf element Wtf7|Schizosaccharomyces pombe|chr... 26 2.9 SPAC227.15 |||protein phosphatase regulatory subunit Reg1 |Schiz... 26 2.9 SPAC5D6.04 |||auxin family transmembrane transporter |Schizosacc... 26 3.8 SPCPB16A4.06c |||sequence orphan|Schizosaccharomyces pombe|chr 3... 25 6.7 SPBPB2B2.17c |||dubious|Schizosaccharomyces pombe|chr 2|||Manual 25 8.9 SPCC794.06 |||TDT malic acid transporter|Schizosaccharomyces pom... 25 8.9 >SPCC736.05 |wtf7||wtf element Wtf7|Schizosaccharomyces pombe|chr 3|||Manual Length = 220 Score = 26.2 bits (55), Expect = 2.9 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = -1 Query: 229 KLPPLRRNKICSRKLTLRSIMILI---FFFTECLYFRKIS 119 +L P +N + + +S+ +L+ F F CL+FRK S Sbjct: 104 RLRPFAKNGVTNGVKLAQSLFLLLPFNFIFFACLFFRKAS 143 >SPAC227.15 |||protein phosphatase regulatory subunit Reg1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 873 Score = 26.2 bits (55), Expect = 2.9 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 6/53 (11%) Frame = -2 Query: 438 DRGDNAGPSDRDSDIF------RTLPPTLNPAFSADSEARRDL*ELYMSQSFF 298 D A P +DS +F ++P +NPA++ + L E Y+S FF Sbjct: 115 DTYSTAIPFSKDSSVFDAVGQQSSVPIHINPAYTNSHQNSYSLNETYLSYDFF 167 >SPAC5D6.04 |||auxin family transmembrane transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 452 Score = 25.8 bits (54), Expect = 3.8 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = -1 Query: 160 IFFFTECLYFRKISGFCRNL*VKLEFSWINPSITV*AAAFTSMSHSLNRL 11 ++FFT CL F K+ G NL + ++ S + + +AA +S L +L Sbjct: 55 VYFFTPCLVFEKV-GNGLNLKMLIDLSLLPVFYVIISAASILISFLLAKL 103 >SPCPB16A4.06c |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 126 Score = 25.0 bits (52), Expect = 6.7 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 5/34 (14%) Frame = +3 Query: 357 RRRGSTWEAG--CGKYRS--HGPKARR-CHHDRQ 443 +R GS A C +YRS HGP+ RR HD Q Sbjct: 37 QRHGSRASADEFCEQYRSRSHGPQGRRSLEHDNQ 70 >SPBPB2B2.17c |||dubious|Schizosaccharomyces pombe|chr 2|||Manual Length = 146 Score = 24.6 bits (51), Expect = 8.9 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -3 Query: 254 LFCWNVFREIASVETK 207 L+CW ++ E+ SV +K Sbjct: 53 LYCWYIYSEVPSVSSK 68 >SPCC794.06 |||TDT malic acid transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 431 Score = 24.6 bits (51), Expect = 8.9 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -1 Query: 169 MILIFFFTECLYFRKI-SGFCRNL*VKLEFSW 77 MI + F CL F + +GFC +K + SW Sbjct: 289 MIGLGIFNFCLAFVSVVAGFCTRQRIKFKVSW 320 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,912,284 Number of Sequences: 5004 Number of extensions: 35617 Number of successful extensions: 107 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -