BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0609 (517 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC005186-1|AAH05186.1| 142|Homo sapiens mitochondrial ribosomal... 31 3.2 AF151892-1|AAD34129.1| 142|Homo sapiens CGI-134 protein protein. 31 3.2 AK126969-1|BAC86769.1| 245|Homo sapiens protein ( Homo sapiens ... 29 7.3 >BC005186-1|AAH05186.1| 142|Homo sapiens mitochondrial ribosomal protein S18C protein. Length = 142 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = -1 Query: 220 PLRRNKICSRKLTLRSIMILIFF---FTECLYFRKISGFC 110 PL++ +C + + +++ +L F FT C+Y R I+G C Sbjct: 61 PLKKCILCGKHVDYKNVQLLSQFVSPFTGCIYGRHITGLC 100 >AF151892-1|AAD34129.1| 142|Homo sapiens CGI-134 protein protein. Length = 142 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = -1 Query: 220 PLRRNKICSRKLTLRSIMILIFF---FTECLYFRKISGFC 110 PL++ +C + + +++ +L F FT C+Y R I+G C Sbjct: 61 PLKKCILCGKHVDYKNVQLLSQFVSPFTGCIYGRHITGLC 100 >AK126969-1|BAC86769.1| 245|Homo sapiens protein ( Homo sapiens cDNA FLJ45022 fis, clone BRAWH3016715. ). Length = 245 Score = 29.5 bits (63), Expect = 7.3 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +3 Query: 300 RTIGTYTTLKGPVEPQNRRRRRGSTWEAGCGKY-RSHGPKARRCH 431 R G +TTL GP+ Q R G W A + R H P CH Sbjct: 58 RAWGRHTTLLGPLGLQGPGCRPGCWWLASMATHGRLHAPYLLLCH 102 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 66,412,845 Number of Sequences: 237096 Number of extensions: 1235437 Number of successful extensions: 3562 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3562 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4876707572 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -