BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0608 (586 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g44450.1 68418.m05447 expressed protein contains Pfam profile... 27 9.2 At3g13772.1 68416.m01738 endomembrane protein 70, putative TM4 f... 27 9.2 >At5g44450.1 68418.m05447 expressed protein contains Pfam profile PF05891: Eukaryotic protein of unknown function (DUF858) Length = 276 Score = 27.1 bits (57), Expect = 9.2 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -1 Query: 334 RFFGETALYEILGQRLALCKENLATLLHET*P*YTFTLVILKRFS 200 R+F E L E + Q L +ENLA+ ET F V L+ F+ Sbjct: 109 RYFNEVDLLEPVAQFLDAARENLASAGSETHKATNFFCVPLQEFT 153 >At3g13772.1 68416.m01738 endomembrane protein 70, putative TM4 family; Length = 641 Score = 27.1 bits (57), Expect = 9.2 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -2 Query: 75 YLFVYSFFYFTSKLK 31 YLF+YS FYF +KL+ Sbjct: 580 YLFLYSIFYFFTKLE 594 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,459,373 Number of Sequences: 28952 Number of extensions: 180397 Number of successful extensions: 259 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 258 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 259 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1151426952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -