BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0607 (646 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0764 - 31804811-31804915,31805013-31805072,31805720-318059... 42 6e-04 08_02_0822 + 21549257-21550729,21550776-21550877 31 1.0 07_03_0674 + 20598668-20598774,20599456-20600467 30 1.4 08_02_0318 + 15710834-15711775 29 4.2 05_03_0387 + 13396158-13396271,13396390-13396434,13397004-133976... 27 9.7 >01_06_0764 - 31804811-31804915,31805013-31805072,31805720-31805959, 31807367-31807525,31807653-31807769 Length = 226 Score = 41.5 bits (93), Expect = 6e-04 Identities = 38/158 (24%), Positives = 68/158 (43%), Gaps = 5/158 (3%) Frame = +3 Query: 162 EIRSDIEEINDLLKQAKRKKVQDLLSLEIRXXXXXXXXXXXXXXXXPMEV-SPIPTTSTS 338 E+R D+EE+ L AKR +V L+ EIR + SP + + Sbjct: 5 ELRLDLEELRRLEGLAKRPRVLSALANEIRAVDAKLAKATEPQAPQAVAAGSPPVVAAAA 64 Query: 339 APVQKK----YQVKLNVYGWDQSDKFVKVFVELKNVHTLPKEQVYCKLTDKSMELHVDNL 506 AP V L + WDQ + +K++V L+ V +++V S++ ++ Sbjct: 65 APAPAAAAGVSYVTLGSFSWDQDAEKIKIYVFLEGVE---QDKVETTFKPMSVDTKFHDV 121 Query: 507 ENKDYLLVINKLLEPINVADSHWKQKTDQVVIFLAKSN 620 + K+Y I KL + I K ++++ L K++ Sbjct: 122 KGKNYRCAIPKLHKEIVPEKCKVLVKPTKIIVTLYKAS 159 >08_02_0822 + 21549257-21550729,21550776-21550877 Length = 524 Score = 30.7 bits (66), Expect = 1.0 Identities = 11/41 (26%), Positives = 28/41 (68%) Frame = +3 Query: 471 TDKSMELHVDNLENKDYLLVINKLLEPINVADSHWKQKTDQ 593 ++K +E++ D +NK+ ++++ ++ E +N+ +SH + T Q Sbjct: 438 SEKMVEMN-DTRKNKEQIIMLKEVYEQLNMIESHMRPSTSQ 477 >07_03_0674 + 20598668-20598774,20599456-20600467 Length = 372 Score = 30.3 bits (65), Expect = 1.4 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = +3 Query: 300 PMEVSPIPTTSTSAPVQKKYQVKLNVYGWDQSDKFVKVFV-ELKNVHTLPKEQVYCKLTD 476 P +VSP P P++K + K ++Y FVK + ++ N H E ++ +L+ Sbjct: 220 PPQVSPTPAIDVLLPIEKAQKAKRDIYA---VSYFVKAGLGKVLNPHKERMENLFKRLSP 276 Query: 477 KSMELHV 497 + EL+V Sbjct: 277 WAPELYV 283 >08_02_0318 + 15710834-15711775 Length = 313 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = -2 Query: 333 YLLWVLVILPWASKFPFLLMLLVLSQVF*SPRRVNPVLSYV 211 Y L LV++P P ++ L LS V+ +PRR +PV +++ Sbjct: 228 YALAALVVVP----LPVQVVALALSSVWETPRRTSPVAAFL 264 >05_03_0387 + 13396158-13396271,13396390-13396434,13397004-13397632, 13397727-13397874,13397971-13398147,13398527-13398595, 13398699-13398788,13399000-13399158,13399663-13399753, 13399917-13400008,13400009-13400233,13400394-13400585 Length = 676 Score = 27.5 bits (58), Expect = 9.7 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 4/62 (6%) Frame = +3 Query: 300 PMEVSPIPTTSTSAPVQKKYQVK-LNVYGWDQSDKFVK---VFVELKNVHTLPKEQVYCK 467 P ++ + + P K QVK LN G + + + + VF+ELKN L + +C+ Sbjct: 467 PSYLAKVQWDESFGPKMDKLQVKGLNHGGIESAKQALNESGVFLELKNALNLWRPLTFCR 526 Query: 468 LT 473 LT Sbjct: 527 LT 528 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,127,133 Number of Sequences: 37544 Number of extensions: 277868 Number of successful extensions: 588 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 588 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1596695220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -