BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0607 (646 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g30070.1 68414.m03676 SGS domain-containing protein similar t... 60 2e-09 At5g58740.1 68418.m07358 nuclear movement family protein contain... 38 0.004 At1g80910.1 68414.m09493 expressed protein 29 2.0 At2g44410.1 68415.m05523 expressed protein 29 3.5 At2g31400.1 68415.m03837 pentatricopeptide (PPR) repeat-containi... 29 3.5 At2g07770.1 68415.m01005 hypothetical protein low similarity to ... 29 3.5 At1g47300.1 68414.m05237 F-box family protein similar to hypothe... 27 8.1 >At1g30070.1 68414.m03676 SGS domain-containing protein similar to calcyclin binding protein [Mus musculus] GI:3142331; contains Pfam profile PF05002: SGS domain Length = 222 Score = 59.7 bits (138), Expect = 2e-09 Identities = 40/157 (25%), Positives = 75/157 (47%), Gaps = 3/157 (1%) Frame = +3 Query: 159 QEIRSDIEEINDLLKQAKRKKVQDLLSLEIRXXXXXXXXXXXXXXXXPMEVS-PIPTTST 335 +E+ D+EE+ L AKR +V +L++ EI + V+ P P +S+ Sbjct: 3 EEVGLDLEELRQLQNIAKRPRVLNLINSEISNLEKLRDSAVSSNAKPKVPVTVPAPVSSS 62 Query: 336 SAPVQKK--YQVKLNVYGWDQSDKFVKVFVELKNVHTLPKEQVYCKLTDKSMELHVDNLE 509 PV V L + WDQ + VK+++ L+ V +++V + S+++ + +++ Sbjct: 63 GKPVSSSALNYVTLGTFSWDQDNDKVKMYISLEGV---DEDKVQAEFKPMSLDIKIHDVQ 119 Query: 510 NKDYLLVINKLLEPINVADSHWKQKTDQVVIFLAKSN 620 K+Y I KL + I K ++VI + KS+ Sbjct: 120 GKNYRCAIPKLCKEIMPEKCKVLVKPKRIVITMVKSS 156 >At5g58740.1 68418.m07358 nuclear movement family protein contains Pfam profile: PF03593 nuclear movement protein Length = 158 Score = 38.3 bits (85), Expect = 0.004 Identities = 28/89 (31%), Positives = 44/89 (49%), Gaps = 1/89 (1%) Frame = +3 Query: 375 VYGWDQSDKFVKVFVELK-NVHTLPKEQVYCKLTDKSMELHVDNLENKDYLLVINKLLEP 551 V+ WDQ+ + V +++ L NVH PK +CK+ K +E+ + N YL + L P Sbjct: 20 VFEWDQTLEEVNMYITLPPNVH--PKS-FHCKIQSKHIEVGIKG--NPPYLN--HDLSAP 72 Query: 552 INVADSHWKQKTDQVVIFLAKSNPNTTWS 638 + S W + D + I L K TW+ Sbjct: 73 VKTDCSFWTLEDDIMHITLQKREKGQTWA 101 >At1g80910.1 68414.m09493 expressed protein Length = 497 Score = 29.5 bits (63), Expect = 2.0 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +3 Query: 513 KDYLLVINKLLEPINVADSHWKQKTDQVVIFLAKSNPNTTW 635 K+ LL +NKL E ++ + KQ+ D + AK+N TW Sbjct: 416 KESLLALNKLREEVDTEKNRSKQEKDMEICIRAKNN---TW 453 >At2g44410.1 68415.m05523 expressed protein Length = 413 Score = 28.7 bits (61), Expect = 3.5 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = -2 Query: 597 LPDLFFVSNDCLPHL*VPI-TC**QASNLYFPDCPHAAPLIYLSIYNIPV 451 +P FF N CL PI TC +L+ C + PLIYL+I PV Sbjct: 118 VPGGFFDCNICLEKAEDPILTC---CGHLFCWGCFYQLPLIYLNIKECPV 164 >At2g31400.1 68415.m03837 pentatricopeptide (PPR) repeat-containing protein low similarity to fertility restorer [Petunia x hybrida] GI:22128587, post-transcriptional control of chloroplast gene expression CRP1 [Zea mays] GI:3289002; contains Pfam profile PF01535: PPR repeat Length = 918 Score = 28.7 bits (61), Expect = 3.5 Identities = 16/41 (39%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +3 Query: 357 YQVKLNVYGWD-QSDKFVKVFVELKNVHTLPKEQVYCKLTD 476 Y L YG + D+ KVF E+K H LP Y L D Sbjct: 482 YNALLGGYGKQGKYDEVKKVFTEMKREHVLPNLLTYSTLID 522 >At2g07770.1 68415.m01005 hypothetical protein low similarity to KED [Nicotiana tabacum] GI:8096269; contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 518 Score = 28.7 bits (61), Expect = 3.5 Identities = 15/65 (23%), Positives = 34/65 (52%) Frame = +3 Query: 36 YK*STLLDFKIAD*RCLFVISKDLHSIQTNCSFIKMSEAKIQEIRSDIEEINDLLKQAKR 215 +K ST+ F ++D +KD+ SI + K+ +I + ++ +++DL+ + Sbjct: 120 FKSSTMKGFPMSDVYDKLGTTKDIQSILASTPDEKLLLERIMDKECEVNDVDDLIADGWK 179 Query: 216 KKVQD 230 K++ D Sbjct: 180 KRLVD 184 >At1g47300.1 68414.m05237 F-box family protein similar to hypothetical protein GB:AAD22295 GI:4544385 from [Arabidopsis thaliana] Length = 306 Score = 27.5 bits (58), Expect = 8.1 Identities = 15/50 (30%), Positives = 28/50 (56%) Frame = +3 Query: 312 SPIPTTSTSAPVQKKYQVKLNVYGWDQSDKFVKVFVELKNVHTLPKEQVY 461 +PI S P K+Y+ +L+ +G+D DK K + LK ++L ++ + Sbjct: 134 NPITGRYASLPYLKRYRKELSFFGFDPIDKQFKEW--LKYAYSLRDDKFF 181 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,880,801 Number of Sequences: 28952 Number of extensions: 245776 Number of successful extensions: 696 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 678 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 696 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1334473344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -