BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0604 (416 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 25 1.5 AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 24 1.9 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 24 2.5 AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 24 2.5 AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 23 3.4 AY973196-1|AAY41590.1| 94|Anopheles gambiae defensin 4 protein. 23 4.5 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 5.9 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 23 5.9 AF269156-1|AAF91401.1| 52|Anopheles gambiae transcription fact... 22 7.8 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 24.6 bits (51), Expect = 1.5 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 194 ILQEKIPKEQEKIREFRKKHGST 262 +L EK+ KE K+R F KK +T Sbjct: 247 LLCEKVVKEDIKVRFFEKKGNAT 269 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 24.2 bits (50), Expect = 1.9 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = +2 Query: 161 GLSAEQTNLKSILQE--KIPKEQEKIREFRKKHGSTKVGEVTVDMMYG 298 G T + L E K P QE++R+ + GE+T DM+ G Sbjct: 315 GFETSSTVMNFCLYELAKNPHIQERLRDELNRSIDANGGELTYDMVMG 362 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 23.8 bits (49), Expect = 2.5 Identities = 22/91 (24%), Positives = 41/91 (45%), Gaps = 6/91 (6%) Frame = +2 Query: 155 LRGLSAEQTNLKSILQE--KIPKEQEKIREFRKKHGSTKVGEVTVDMMYGGMRGIKGLVW 328 L G T + L E K P Q ++RE ++ GEVT DM+ ++ + ++ Sbjct: 310 LAGSETSSTTMNFCLYELAKNPDIQGRLREEIERAVEENGGEVTYDMVM-NVQYLDSVIN 368 Query: 329 ET----SVLDADEGIRFRGLSIPECQQQLPK 409 ET +++ + R ++P + +PK Sbjct: 369 ETLRKYPPIESLSRVPMRDYTVPGTKHVIPK 399 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 23.8 bits (49), Expect = 2.5 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = +2 Query: 155 LRGLSAEQTNLKSILQE--KIPKEQEKIREFRKKHGSTKVGEVTVDMMYG 298 L G T + L E K P QE++R ++ GE+T D++ G Sbjct: 311 LAGFETSSTTMNFCLYELAKHPDIQERLRREIERAVEENGGELTYDVVMG 360 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 23.4 bits (48), Expect = 3.4 Identities = 17/62 (27%), Positives = 26/62 (41%), Gaps = 2/62 (3%) Frame = +2 Query: 113 LVELQKACPTATVLLRGLSAEQTNLKSILQE--KIPKEQEKIREFRKKHGSTKVGEVTVD 286 + + + A L G T L E K P QE++RE + + GEVT D Sbjct: 299 MTQNELAAQAFVFFLAGFETSSTTQSFCLYELAKNPDIQERLREEINRAIAENGGEVTYD 358 Query: 287 MM 292 ++ Sbjct: 359 VV 360 >AY973196-1|AAY41590.1| 94|Anopheles gambiae defensin 4 protein. Length = 94 Score = 23.0 bits (47), Expect = 4.5 Identities = 18/60 (30%), Positives = 29/60 (48%) Frame = -3 Query: 390 HSGMDRPRKRIPSSASSTEVSQTRPLIPRMPPYIISTVTSPTLVEPCFFRNSRIFSCSLG 211 +S +RP + AS+ V+Q+R + + T T+PT C R R SC++G Sbjct: 33 NSPAERPHIQPFQMASAPLVAQSRSAMVQT-----LTCTNPTCSAQCRGRGYRRGSCTIG 87 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 5.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 354 SSASSTEVSQTRPLIPRMPP 295 SSASST ++ + P+ PP Sbjct: 516 SSASSTSLNHSNPISSSAPP 535 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 22.6 bits (46), Expect = 5.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 354 SSASSTEVSQTRPLIPRMPP 295 SSASST ++ + P+ PP Sbjct: 517 SSASSTSLNHSNPISSSAPP 536 >AF269156-1|AAF91401.1| 52|Anopheles gambiae transcription factor zen protein. Length = 52 Score = 22.2 bits (45), Expect = 7.8 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 101 TSSRLVELQKACPTATVLLRGLSAEQTNLKSILQEKI 211 TSS+LVEL+K + L R E T ++ + +I Sbjct: 8 TSSQLVELEKEFHSNRYLCRPRRIELTRKLALTERQI 44 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 439,472 Number of Sequences: 2352 Number of extensions: 8271 Number of successful extensions: 19 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34205040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -