BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0599 (545 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 25 2.2 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 5.0 AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 23 6.6 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 23 8.7 AY752901-1|AAV30075.1| 90|Anopheles gambiae peroxidase 7 protein. 23 8.7 AY341174-1|AAR13738.1| 280|Anopheles gambiae fibrinogen protein. 23 8.7 AY341173-1|AAR13737.1| 280|Anopheles gambiae fibrinogen protein. 23 8.7 AY341172-1|AAR13736.1| 280|Anopheles gambiae fibrinogen protein. 23 8.7 AY341171-1|AAR13735.1| 280|Anopheles gambiae fibrinogen protein. 23 8.7 AY341170-1|AAR13734.1| 280|Anopheles gambiae fibrinogen protein. 23 8.7 AY341169-1|AAR13733.1| 280|Anopheles gambiae fibrinogen protein. 23 8.7 AY341168-1|AAR13732.1| 280|Anopheles gambiae fibrinogen protein. 23 8.7 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 24.6 bits (51), Expect = 2.2 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +3 Query: 189 ALTGNEVLKIVKQRLIKVDGKVRTDPTYPAGFMDVVSIEKTNE 317 ++TG ++LK KQ+L +DG + ++ D+ I++ E Sbjct: 575 SVTGTKLLKKTKQQLEPLDGTLGWRRSHRPSLHDISIIDEEEE 617 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.4 bits (48), Expect = 5.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 470 ADGAAIMRYQVRNILRSGRHTLDFTQLVLS 381 AD AA +RY + + RH L + Q ++S Sbjct: 483 ADTAAELRYAKEHADKENRHFLQYAQDLIS 512 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 23.0 bits (47), Expect = 6.6 Identities = 11/50 (22%), Positives = 22/50 (44%) Frame = -1 Query: 287 HKSSRISRVSPNFPINLYEALFHNFQDFVSGQSILQTIPQENHQXASTRA 138 H S + + +P F +N+Y+ L D +G ++ + + T A Sbjct: 80 HLHSSVGKSAPQFLLNVYDQLQQEETDAPAGAGRIRKVRSTDMDILITEA 129 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 22.6 bits (46), Expect = 8.7 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +3 Query: 297 SIEKTNELFRLIYDVKGRFTIHRI 368 S+E N + IYD+KG+ ++ Sbjct: 177 SLEHLNLQYNFIYDIKGQVVFAKL 200 >AY752901-1|AAV30075.1| 90|Anopheles gambiae peroxidase 7 protein. Length = 90 Score = 22.6 bits (46), Expect = 8.7 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 108 AYTPPSLSNIHALGAFKRF 52 A+T PS+ N H AF+ F Sbjct: 64 AFTNPSVINSHTTAAFRFF 82 >AY341174-1|AAR13738.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 8.7 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +3 Query: 105 MHRDRQPVPTSCASAC 152 M RD PT+CA C Sbjct: 249 MDRDNDGAPTNCAVTC 264 >AY341173-1|AAR13737.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 8.7 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +3 Query: 105 MHRDRQPVPTSCASAC 152 M RD PT+CA C Sbjct: 249 MDRDNDGAPTNCAVTC 264 >AY341172-1|AAR13736.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 8.7 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +3 Query: 105 MHRDRQPVPTSCASAC 152 M RD PT+CA C Sbjct: 249 MDRDNDGAPTNCAVTC 264 >AY341171-1|AAR13735.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 8.7 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +3 Query: 105 MHRDRQPVPTSCASAC 152 M RD PT+CA C Sbjct: 249 MDRDNDGAPTNCAVTC 264 >AY341170-1|AAR13734.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 8.7 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +3 Query: 105 MHRDRQPVPTSCASAC 152 M RD PT+CA C Sbjct: 249 MDRDNDGAPTNCAVTC 264 >AY341169-1|AAR13733.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 8.7 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +3 Query: 105 MHRDRQPVPTSCASAC 152 M RD PT+CA C Sbjct: 249 MDRDNDGAPTNCAVTC 264 >AY341168-1|AAR13732.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 8.7 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +3 Query: 105 MHRDRQPVPTSCASAC 152 M RD PT+CA C Sbjct: 249 MDRDNDGAPTNCAVTC 264 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 610,669 Number of Sequences: 2352 Number of extensions: 12765 Number of successful extensions: 68 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50460840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -