BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0597 (576 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 49 9e-08 CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 27 0.58 DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 23 7.1 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 23 7.1 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 23 7.1 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 23 7.1 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 7.1 DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 23 9.4 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 9.4 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 49.2 bits (112), Expect = 9e-08 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +2 Query: 500 NAVITVPAYFNDSQRQATKDAGTIS 574 +AVITVPAYFNDSQRQATKDAG I+ Sbjct: 1 DAVITVPAYFNDSQRQATKDAGAIA 25 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 26.6 bits (56), Expect = 0.58 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -3 Query: 175 VVGDDLHLPVLEDTNARVRGTQIDSYCGCFCHFVPFN 65 V D P++ + +++G I + CG FC + FN Sbjct: 15 VHAQDASRPIINTSGGQIQG--ITASCGLFCSYFAFN 49 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 23.0 bits (47), Expect = 7.1 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 490 NCAECSYHGSRVLQ*LSKTSHKR-CRY 567 NCA C HG ++ HKR C+Y Sbjct: 40 NCARCRNHGLKI----GLKGHKRYCKY 62 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 23.0 bits (47), Expect = 7.1 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 490 NCAECSYHGSRVLQ*LSKTSHKR-CRY 567 NCA C HG ++ HKR C+Y Sbjct: 40 NCARCRNHGLKI----GLKGHKRYCKY 62 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 23.0 bits (47), Expect = 7.1 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 490 NCAECSYHGSRVLQ*LSKTSHKR-CRY 567 NCA C HG ++ HKR C+Y Sbjct: 40 NCARCRNHGLKI----GLKGHKRYCKY 62 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 23.0 bits (47), Expect = 7.1 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 490 NCAECSYHGSRVLQ*LSKTSHKR-CRY 567 NCA C HG ++ HKR C+Y Sbjct: 40 NCARCRNHGLKI----GLKGHKRYCKY 62 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 7.1 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 79 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR 168 +GK RS + +++LL P REG H+ Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHK 1831 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 22.6 bits (46), Expect = 9.4 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -3 Query: 85 CHFVPFNQSCYLFLKQLS 32 CH VP Q C +++ L+ Sbjct: 168 CHTVPLAQGCSVYISTLT 185 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 9.4 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 129 QEYVVPRSIPTAGAFA 82 Q+Y PR++ +AG FA Sbjct: 1244 QDYAPPRALMSAGGFA 1259 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 644,720 Number of Sequences: 2352 Number of extensions: 13348 Number of successful extensions: 29 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54665910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -