BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0592 (639 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0413 - 23242228-23242517,23242732-23243180,23243338-23244458 29 4.1 >11_06_0413 - 23242228-23242517,23242732-23243180,23243338-23244458 Length = 619 Score = 28.7 bits (61), Expect = 4.1 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = +3 Query: 84 VFCYDIFSKL*TLIGSPEKSNIVAYINNNINKIYLTQLIKDKYHFQFSFRYRY 242 VFC + S TL+ S K ++ +++ I K+Y + DK ++ +RY Sbjct: 310 VFCRGLLSLSFTLLLSLVKVSMASWLYAKIGKVYYPKSELDKARGSLTYSFRY 362 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,645,016 Number of Sequences: 37544 Number of extensions: 182079 Number of successful extensions: 249 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 247 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 249 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1573040476 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -