BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0592 (639 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77855.1 68414.m09073 hypothetical protein 29 2.6 At1g22030.1 68414.m02756 expressed protein 29 3.4 >At1g77855.1 68414.m09073 hypothetical protein Length = 317 Score = 29.1 bits (62), Expect = 2.6 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -1 Query: 603 FYPFLTRSLEEHERLRFRQFPLSRLTRDKTQCTLRLSVYYLCFKTDKL 460 FY FL RS+E+ ER+ +S + C LR S +L KL Sbjct: 12 FYSFLNRSMEDLERVYISNNFMSLQFLQRVICLLRTSHSHLTLLVQKL 59 >At1g22030.1 68414.m02756 expressed protein Length = 333 Score = 28.7 bits (61), Expect = 3.4 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -1 Query: 603 FYPFLTRSLEEHERLRFRQFPLSRLTRDKTQCTLRLSVYYLCFKTDKL 460 FY FL RS+E+ ER+ +S + C LR S +L KL Sbjct: 12 FYSFLNRSMEDLERVYLSNNFMSVHFLQRALCLLRTSHSHLTLLVQKL 59 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,318,149 Number of Sequences: 28952 Number of extensions: 172160 Number of successful extensions: 303 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 300 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 303 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1314848736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -