BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0582 (579 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 26 0.23 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 6.7 DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 21 8.8 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 8.8 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 21 8.8 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 26.2 bits (55), Expect = 0.23 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +1 Query: 7 LSVRYTSIPTSVTISLNPNLLPERIPGS*TS*RRSCQQLAVPHH 138 + + ++PTS T S +P LP+ +P S T + +L+ HH Sbjct: 360 MEIPNVTLPTS-TYSGSPTELPKHLPTSLTKSKMEVMELSDLHH 402 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 19 YTSIPTSVTISLNPNLLP 72 YT+ P ++ LNPN P Sbjct: 210 YTACPPTLACPLNPNPQP 227 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 21.0 bits (42), Expect = 8.8 Identities = 10/40 (25%), Positives = 18/40 (45%) Frame = +3 Query: 294 EWLAKRHLRCCTSNSTLQSIYTRNRTLQTLSGSKLRLCQL 413 +W++ + + L +TL T +GS L +C L Sbjct: 80 KWISPGDTKVMVEHGELVMGILCKKTLGTSAGSLLHICML 119 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.0 bits (42), Expect = 8.8 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +3 Query: 72 RTDTRILNILKKKLSATGRTAPLL 143 R D RIL++ + +++ +PLL Sbjct: 211 RADIRILDLSRNEITRLQENSPLL 234 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 21.0 bits (42), Expect = 8.8 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 33 YKCNNFAQPQLASRTDTRILNILK 104 ++C+ + P L R R LNI K Sbjct: 98 FECSKTSNPCLPHRNSDRDLNIRK 121 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,750 Number of Sequences: 438 Number of extensions: 3919 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16748661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -