BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0578 (318 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 22 1.4 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 3.1 AY052395-1|AAL15469.1| 76|Tribolium castaneum tryptophan oxyge... 21 4.1 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 21 4.1 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 21 4.1 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 20 5.5 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 22.2 bits (45), Expect = 1.4 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -3 Query: 178 CGRTAIVTPNTRST*SHRQRAYVHQSAVVRVV 83 C TA+VTP+ S +RQ Y S +V Sbjct: 34 CVVTALVTPSALSIIYYRQPIYAKISETKSIV 65 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.0 bits (42), Expect = 3.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +1 Query: 193 VYPLYTFQPDSWANVRDETRLYF 261 + PLYT + + +R+ RLY+ Sbjct: 52 ILPLYTSAENIFKQLREWGRLYY 74 >AY052395-1|AAL15469.1| 76|Tribolium castaneum tryptophan oxygenase protein. Length = 76 Score = 20.6 bits (41), Expect = 4.1 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 271 EAQDWLDELNNDPNH 315 EAQ L E NN P H Sbjct: 35 EAQRLLSEQNNQPVH 49 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 20.6 bits (41), Expect = 4.1 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 271 EAQDWLDELNNDPNH 315 EAQ L E NN P H Sbjct: 35 EAQRLLSEQNNQPVH 49 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 20.6 bits (41), Expect = 4.1 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 271 EAQDWLDELNNDPNH 315 EAQ L E NN P H Sbjct: 35 EAQRLLSEQNNQPVH 49 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 20.2 bits (40), Expect = 5.5 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +1 Query: 199 PLYTFQPDSWANVRDETRLYF 261 PLYT + + +R+ RLY+ Sbjct: 54 PLYTSAENIFKQLREWGRLYY 74 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,467 Number of Sequences: 336 Number of extensions: 1396 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 5942776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -