BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0577 (543 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) 39 0.002 SB_59202| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_25762| Best HMM Match : VWD (HMM E-Value=2.2e-16) 38 0.005 SB_44878| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_45766| Best HMM Match : F5_F8_type_C (HMM E-Value=3.1e-27) 36 0.021 SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.037 SB_57949| Best HMM Match : PAN (HMM E-Value=0.13) 35 0.037 SB_27190| Best HMM Match : PAN (HMM E-Value=0.13) 35 0.037 SB_2045| Best HMM Match : EGF (HMM E-Value=0) 35 0.049 SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.086 SB_19025| Best HMM Match : Keratin_B2 (HMM E-Value=1.3) 33 0.11 SB_26369| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_26365| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_41134| Best HMM Match : EGF_CA (HMM E-Value=0) 33 0.20 SB_16910| Best HMM Match : EGF (HMM E-Value=0) 33 0.20 SB_25361| Best HMM Match : Cadherin (HMM E-Value=0) 32 0.26 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.26 SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.26 SB_47942| Best HMM Match : TSP_1 (HMM E-Value=0) 32 0.35 SB_17530| Best HMM Match : EGF_CA (HMM E-Value=0) 32 0.35 SB_11257| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.7e-11) 31 0.46 SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) 31 0.46 SB_8177| Best HMM Match : TSP_1 (HMM E-Value=6e-38) 31 0.46 SB_55808| Best HMM Match : Pentaxin (HMM E-Value=1.2e-08) 31 0.61 SB_45116| Best HMM Match : EGF (HMM E-Value=0) 31 0.61 SB_18624| Best HMM Match : EGF (HMM E-Value=7.8e-06) 31 0.80 SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 30 1.1 SB_55657| Best HMM Match : EGF_CA (HMM E-Value=0) 30 1.1 SB_52882| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_48384| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_10656| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_10244| Best HMM Match : Laminin_EGF (HMM E-Value=0) 30 1.4 SB_52861| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_45709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_5000| Best HMM Match : EGF_CA (HMM E-Value=0) 29 1.9 SB_52240| Best HMM Match : DUF1700 (HMM E-Value=4.1) 29 1.9 SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) 29 1.9 SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_44830| Best HMM Match : I-set (HMM E-Value=1.1e-08) 29 2.5 SB_48688| Best HMM Match : Ldl_recept_a (HMM E-Value=7.8e-26) 29 2.5 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_30577| Best HMM Match : Ldl_recept_a (HMM E-Value=2.8e-25) 29 2.5 SB_6077| Best HMM Match : EGF (HMM E-Value=0) 29 2.5 SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_52147| Best HMM Match : EGF (HMM E-Value=0) 29 3.2 SB_51898| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_33986| Best HMM Match : EGF_CA (HMM E-Value=3.5e-17) 29 3.2 SB_51974| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_47927| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) 28 4.3 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 28 4.3 SB_12832| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_55591| Best HMM Match : TIL (HMM E-Value=4.2e-09) 28 4.3 SB_52794| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_39250| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) 28 4.3 SB_22765| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_32719| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_26085| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_11375| Best HMM Match : EGF_CA (HMM E-Value=0) 28 5.7 SB_30923| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_22953| Best HMM Match : EGF_2 (HMM E-Value=1.3e-14) 28 5.7 SB_53569| Best HMM Match : EGF_CA (HMM E-Value=0) 27 7.5 SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) 27 7.5 SB_18560| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_14155| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_6771| Best HMM Match : Aldedh (HMM E-Value=0) 27 7.5 SB_18929| Best HMM Match : BRCT (HMM E-Value=1.4e-08) 27 9.9 SB_6273| Best HMM Match : MAM (HMM E-Value=0) 27 9.9 >SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) Length = 3891 Score = 39.1 bits (87), Expect = 0.002 Identities = 30/111 (27%), Positives = 43/111 (38%), Gaps = 13/111 (11%) Frame = -3 Query: 538 VDQKSCKAG-CVCKEGYL--KDDSGKCVARENCPN*ECSGENEEFTNCTNPCPPRTCNSL 368 V Q CK G C+ +E +DD G + C N C + T+ C+ Sbjct: 2459 VTQFRCKTGTCITREWRCDHQDDCGDGSDEQQCVNYTCPNHTFKCTSGHCIANSSVCDGD 2518 Query: 367 VARFDCSKPKPCEEG----------CACKPDYLKLDDNSACVKICECPQMA 245 D S K C+ G C+C+P YL + D +C + EC A Sbjct: 2519 TDCADGSDEKDCDLGTSTCGAGLFRCSCRPGYLLMSDGRSCQDVDECKSYA 2569 Score = 29.5 bits (63), Expect = 1.9 Identities = 22/101 (21%), Positives = 42/101 (41%), Gaps = 3/101 (2%) Frame = -3 Query: 535 DQKSCKAGCVCKEGYLKDDSGKCVAREN-CPN*-ECSGENEEFTNC-TNPCPPRTCNSLV 365 D+ C + + ++ +C+A+ C +C ++E C + C + N Sbjct: 1118 DEVDCGLESCGNDRWRCSNTSRCIAKSQVCDGRVDCPDASDEGPGCGLDQC--HSNNGGC 1175 Query: 364 ARFDCSKPKPCEEGCACKPDYLKLDDNSACVKICECPQMAS 242 A+ P+ + C+C+P + DN C I EC +S Sbjct: 1176 AQLCMDVPEGVQ--CSCRPGFTLASDNKTCEDINECLNSSS 1214 Score = 27.1 bits (57), Expect = 9.9 Identities = 23/88 (26%), Positives = 37/88 (42%), Gaps = 3/88 (3%) Frame = -3 Query: 508 VCKEGYLKDDSGKCVARENCPN*ECSGENEEFTNCTNPCPPRTCNSLVARFDCSKPKPCE 329 +C+ + + D+ KC+ + N C G T+ ++ P R+C + VA C K + Sbjct: 3286 ICRNSHFRCDNNKCIPKWNV----CDGV-YHCTDKSDEAPYRSCPARVA---CRKDQFKC 3337 Query: 328 EGCACKPDYLKLDDNSACVKI---CECP 254 C P D N C I +CP Sbjct: 3338 LNRRCVPVRAVCDSNDDCGDISDELQCP 3365 >SB_59202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1530 Score = 37.9 bits (84), Expect = 0.005 Identities = 35/120 (29%), Positives = 44/120 (36%), Gaps = 29/120 (24%) Frame = -3 Query: 529 KSCKAGCVC-KEGYLKDDSGKCVARENCP-------------------N*ECSGENEEFT 410 + C GC C KEG L ++ KCV + CP N C G + T Sbjct: 1154 RRCVEGCYCEKEGELMNNEHKCVDKTQCPCYYGDTMYKYGEIRKDRCNNCTCKGGVFDCT 1213 Query: 409 N--CTNPCPPRTCNSLVARFDCSK-------PKPCEEGCACKPDYLKLDDNSACVKICEC 257 N C C R C +PC GC C PD L + DN CV+ +C Sbjct: 1214 NVDCEAMCLTRGLVYSDCGITCENLHPINGGERPCVSGCYC-PDGLIMHDNGTCVQSMQC 1272 Score = 34.7 bits (76), Expect = 0.049 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -3 Query: 388 PRTCNSLVARFDCSKPKPCEEGCACKPDYLKLDDNSACVKICECP 254 P TC+ L D + C EGC C+ + +++ CV +CP Sbjct: 1138 PSTCDDLANVTDTCPSRRCVEGCYCEKEGELMNNEHKCVDKTQCP 1182 Score = 33.5 bits (73), Expect = 0.11 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 7/54 (12%) Frame = -3 Query: 532 QKSCKAGCVCKEGYLKDDSGKCVARENCPN*ECSGENEEF-------TNCTNPC 392 ++ C +GC C +G + D+G CV C +C N+ + T+C+ C Sbjct: 1245 ERPCVSGCYCPDGLIMHDNGTCVQSMQC---QCKHNNKYYDAGAISPTDCSRKC 1295 Score = 28.3 bits (60), Expect = 4.3 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -3 Query: 523 CKAGCVCKEGYLKDDSGKCVARENC 449 C GC C EG ++ D GKCV C Sbjct: 787 CVDGCFCPEGKIQ-DRGKCVDPGQC 810 >SB_25762| Best HMM Match : VWD (HMM E-Value=2.2e-16) Length = 705 Score = 37.9 bits (84), Expect = 0.005 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 3/61 (4%) Frame = -3 Query: 427 ENEEFTNCTNPCPPRTCNSLVARFDCSKPKPCEEGCACKPDYLKLDD---NSACVKICEC 257 EN F CT+ CP TC+ R + C EGC CK ++++ + C+K EC Sbjct: 182 ENAVFKYCTSACP-ETCHDPPGRNKTCSMR-CVEGCECKEEFVQRVNAVGKVQCIKRKEC 239 Query: 256 P 254 P Sbjct: 240 P 240 >SB_44878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1338 Score = 36.7 bits (81), Expect = 0.012 Identities = 33/111 (29%), Positives = 45/111 (40%), Gaps = 8/111 (7%) Frame = -3 Query: 535 DQKSCKAGCVCKEGYLKDDSGKCVARENCPN*ECSGENEEFTNCTN--PCPPRTCNSLVA 362 +++ CK CK GY+KD G C +C G +F C C R ++ Sbjct: 994 EKEKCKP-MQCKSGYVKDVCGCCDVCAKTVTQKCGGYWGQFGTCAEGLSCVLRKRGQVLK 1052 Query: 361 RFDCS-KPKPCE-EGCACKP----DYLKLDDNSACVKICECPQMASSPDCP 227 S KP CE CA K + + +N A ICECP+M P Sbjct: 1053 NVQFSFKPGHCEPANCAEKSCGLYETCTMINNEA---ICECPRMCKDKGEP 1100 >SB_45766| Best HMM Match : F5_F8_type_C (HMM E-Value=3.1e-27) Length = 255 Score = 35.9 bits (79), Expect = 0.021 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -3 Query: 337 PCEEGCACKPDYLKLDDNSACVKIC 263 PC+EG CKPD+ K DD +C+K C Sbjct: 81 PCQEGYNCKPDFNK-DDTYSCIKGC 104 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 35.1 bits (77), Expect = 0.037 Identities = 26/93 (27%), Positives = 35/93 (37%), Gaps = 1/93 (1%) Frame = -3 Query: 529 KSCKAGCVCKEGYLKDDSGKCVARENCPN*ECSGENEEFTNCTNPCPPRTCNSLVARFDC 350 + C G C+ YL +SG CVA C E TN + CP Sbjct: 1247 RPCTPGYYCESDYLSTESGLCVAGYYCNGSTVFPRPENQTN-GDRCP----KGHFCPTGS 1301 Query: 349 SKPKPCEEGCACKPDYLKLDDN-SACVKICECP 254 S P+PC G +Y + +N C+ CP Sbjct: 1302 SGPQPCWPGTYADTEYNQFRNNCKPCIPGMYCP 1334 Score = 27.9 bits (59), Expect = 5.7 Identities = 28/95 (29%), Positives = 35/95 (36%) Frame = -3 Query: 523 CKAGCVCKEGYLKDDSGKCVARENCPN*ECSGENEEFTNCTNPCPPRTCNSLVARFDCSK 344 C AG C G C CPN G EF PCP T N+ + S Sbjct: 577 CCAGFYCPSNSSSCSLG-CPTGHYCPN----GTKTEFQY---PCPRGTFNNQTGQQAFSA 628 Query: 343 PKPCEEGCACKPDYLKLDDNSACVKICECPQMASS 239 +PC G C + L + + C K C + A S Sbjct: 629 CEPCLPGKYCGSEGL-TNPSGDCAKGFYCVRGAWS 662 Score = 27.5 bits (58), Expect = 7.5 Identities = 27/112 (24%), Positives = 39/112 (34%), Gaps = 11/112 (9%) Frame = -3 Query: 529 KSCKAGCVCKEGYLKDDSGKCVARENC---------PN*ECSGEN--EEFTNCTNPCPPR 383 K C G C L SG C C P+ +C + E + PCPP Sbjct: 1325 KPCIPGMYCPTYRLSYPSGNCSEGYYCPAGETKQSPPDKQCQPGHYCPEGSGLHRPCPPG 1384 Query: 382 TCNSLVARFDCSKPKPCEEGCACKPDYLKLDDNSACVKICECPQMASSPDCP 227 + + C K C G C P+ ++ N +C + + DCP Sbjct: 1385 SYQPFSEKGICLK---CPPGMYCDPNEARV--NFSCSSVNVSHGTITPSDCP 1431 Score = 27.1 bits (57), Expect = 9.9 Identities = 23/81 (28%), Positives = 29/81 (35%), Gaps = 11/81 (13%) Frame = -3 Query: 523 CKAGCVCKEGYLKDDSGKCVARENCPN*ECSGENEEFT-----NCT------NPCPPRTC 377 C AG C+ L +G C CPN + S + CT PC + Sbjct: 763 CLAGQYCESEGLDTPTGPCDKGYYCPNGQSSKRPSAYVCTPGHYCTEGSPVKRPCASGSY 822 Query: 376 NSLVARFDCSKPKPCEEGCAC 314 R+DC K C EG C Sbjct: 823 QDEYQRWDC---KTCPEGYYC 840 >SB_57949| Best HMM Match : PAN (HMM E-Value=0.13) Length = 230 Score = 35.1 bits (77), Expect = 0.037 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = -3 Query: 337 PCEEGCACKPDYLKLDDNSACVKI 266 PC+EG CKPD+ K DD +C+K+ Sbjct: 140 PCQEGYNCKPDFNK-DDTYSCIKV 162 >SB_27190| Best HMM Match : PAN (HMM E-Value=0.13) Length = 709 Score = 35.1 bits (77), Expect = 0.037 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = -3 Query: 337 PCEEGCACKPDYLKLDDNSACVKI 266 PC+EG CKPD+ K DD +C+K+ Sbjct: 100 PCQEGYNCKPDFNK-DDTYSCIKV 122 >SB_2045| Best HMM Match : EGF (HMM E-Value=0) Length = 1101 Score = 34.7 bits (76), Expect = 0.049 Identities = 27/99 (27%), Positives = 39/99 (39%), Gaps = 5/99 (5%) Frame = -3 Query: 511 CVCKEGYL----KDDSGKCVARENCPN*ECSGENEEFT-NCTNPCPPRTCNSLVARFDCS 347 C+C +G+ + D +C+ C E F +C +TC + D Sbjct: 537 CLCLQGFTGQRCETDIDECLTTPCLNGGTCHDEINNFRCDCPTGYYGKTCTTTTDECD-- 594 Query: 346 KPKPCEEGCACKPDYLKLDDNSACVKICECPQMASSPDC 230 P PC+ G +CK L LD N C CP + DC Sbjct: 595 -PNPCKNGASCKD--LHLDYN------CSCPVGFTGKDC 624 >SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5659 Score = 33.9 bits (74), Expect = 0.086 Identities = 25/82 (30%), Positives = 33/82 (40%), Gaps = 2/82 (2%) Frame = -3 Query: 511 CVCKEGYLKDDSGKCVARENCPN*ECSGENEEFTN--CTNPCPPRTCNSLVARFDCSKPK 338 C C EGY +D GKC C +G+++ N CTN C L R K Sbjct: 484 CQCAEGYERDSQGKCADVNECK----TGKHDCSVNALCTNTDGTFICRCL--RGYIGDGK 537 Query: 337 PCEEGCACKPDYLKLDDNSACV 272 C + CK D N+ C+ Sbjct: 538 TCIDFDECKLPKNDCDVNAECI 559 Score = 32.7 bits (71), Expect = 0.20 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 2/66 (3%) Frame = -3 Query: 421 EEFTNCTNPCPPRT-CNSLVARFDCSKPKPCE-EGCACKPDYLKLDDNSACVKICECPQM 248 +E TN T+ C C +++ F C K E G C P L+ + N AC EC Sbjct: 297 DECTNKTDDCDANALCTNVLGSFVCRCLKGFEGNGKTCIPK-LQTECNPACGNNSECKMQ 355 Query: 247 ASSPDC 230 A+ +C Sbjct: 356 AAGAEC 361 >SB_19025| Best HMM Match : Keratin_B2 (HMM E-Value=1.3) Length = 227 Score = 33.5 bits (73), Expect = 0.11 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = -3 Query: 472 KCVARENCPN*ECSGENEE--FTNCTNPCPPRTCNSLVARFDCSKPKPCEEGC-ACK 311 KC+ + N EC+G N + +T CT C CN+L CS + C + C CK Sbjct: 31 KCIQQCNGTKCECTGRNRDAIYTGCTQLCGRHPCNTLT----CS-TENCIQSCHGCK 82 >SB_26369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 365 Score = 33.1 bits (72), Expect = 0.15 Identities = 20/76 (26%), Positives = 33/76 (43%), Gaps = 1/76 (1%) Frame = -3 Query: 454 NCPN*ECS-GENEEFTNCTNPCPPRTCNSLVARFDCSKPKPCEEGCACKPDYLKLDDNSA 278 NC + +C G + NCTNP P ++ + + +PC+ C+ Y + SA Sbjct: 186 NCSS-KCGIGTHNRTRNCTNPAPAFGGSNCSG--NTMETEPCDNLCSVNGGYTAWSNWSA 242 Query: 277 CVKICECPQMASSPDC 230 C C A + +C Sbjct: 243 CPVTCGAGSQARTRNC 258 >SB_26365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 33.1 bits (72), Expect = 0.15 Identities = 20/76 (26%), Positives = 33/76 (43%), Gaps = 1/76 (1%) Frame = -3 Query: 454 NCPN*ECS-GENEEFTNCTNPCPPRTCNSLVARFDCSKPKPCEEGCACKPDYLKLDDNSA 278 NC + +C G + NCTNP P ++ + + +PC+ C+ Y + SA Sbjct: 209 NCSS-KCGIGTHNRTRNCTNPAPAFGGSNCSG--NTMETEPCDNLCSVNGGYTAWSNWSA 265 Query: 277 CVKICECPQMASSPDC 230 C C A + +C Sbjct: 266 CPVTCGAGSQARTRNC 281 >SB_41134| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 802 Score = 32.7 bits (71), Expect = 0.20 Identities = 27/94 (28%), Positives = 36/94 (38%) Frame = -3 Query: 511 CVCKEGYLKDDSGKCVARENCPN*ECSGENEEFTNCTNPCPPRTCNSLVARFDCSKPKPC 332 C+C +GY + D KCV + C + + N C CN+ A F C C Sbjct: 689 CLCPQGY-RSDWNKCVDIDECADPQ-----------VNKCQ-HICNNTQASFHCE----C 731 Query: 331 EEGCACKPDYLKLDDNSACVKICECPQMASSPDC 230 EG Y+ D C I EC Q +C Sbjct: 732 REG------YILNSDGITCSDIDECKQRMCEKEC 759 Score = 28.3 bits (60), Expect = 4.3 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 322 CACKPDYLKLDDNSACVKICEC 257 C C+ Y+ +DN C+ + EC Sbjct: 292 CQCRQGYVLANDNKTCINLNEC 313 >SB_16910| Best HMM Match : EGF (HMM E-Value=0) Length = 1552 Score = 32.7 bits (71), Expect = 0.20 Identities = 28/100 (28%), Positives = 41/100 (41%), Gaps = 6/100 (6%) Frame = -3 Query: 511 CVCKEGY----LKDDSGKCVARENCPN*ECSGE-NEEFTN-CTNPCPPRTCNSLVARFDC 350 CVC EGY + D G+C ++ N C + E+F C N C+ + DC Sbjct: 1049 CVCPEGYSGRTCQLDFGQCYSKPCKNNATCVDQVGEQFVCLCRNGWEGFYCDKNID--DC 1106 Query: 349 SKPKPCEEGCACKPDYLKLDDNSACVKICECPQMASSPDC 230 + PC G C + ++C C + S PDC Sbjct: 1107 AN-NPCYNGATCV--------DGVGFRLCACAKGFSGPDC 1137 >SB_25361| Best HMM Match : Cadherin (HMM E-Value=0) Length = 4833 Score = 32.3 bits (70), Expect = 0.26 Identities = 21/66 (31%), Positives = 29/66 (43%) Frame = -3 Query: 469 CVARENCPN*ECSGENEEFTNCTNPCPPRTCNSLVARFDCSKPKPCEEGCACKPDYLKLD 290 CV C + C+ N+E T C TC V+ C +P PC+ CKP + D Sbjct: 4254 CVTSGQCQSSPCAN-NKEKTACYEDWDSYTC---VSAAPC-QPDPCKNNATCKP---QKD 4305 Query: 289 DNSACV 272 + CV Sbjct: 4306 ETFLCV 4311 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 32.3 bits (70), Expect = 0.26 Identities = 23/81 (28%), Positives = 32/81 (39%), Gaps = 4/81 (4%) Frame = -3 Query: 460 RENCPN*ECS--GENEEFTNCTNPCPPRTCNSLVARFDCSKPKPCEEGC--ACKPDYLKL 293 R CP CS N +C N CPP+ C S +++ + K C+E C C P Sbjct: 1679 RPECPLICCSVCPPNCSAQSCGNFCPPKCCTSQLSK---DRQKECKESCPKVCGPGCPVQ 1735 Query: 292 DDNSACVKICECPQMASSPDC 230 + + C A P C Sbjct: 1736 CCSDLNICPANCTGSACKPGC 1756 Score = 29.5 bits (63), Expect = 1.9 Identities = 33/118 (27%), Positives = 42/118 (35%), Gaps = 14/118 (11%) Frame = -3 Query: 523 CKAGCVCKEGYLKDDSGKC------VARENCPN*ECSGENEEFTNCTNPCPPRTCNSLVA 362 C C C KD +C V CP CS N NCT C ++ Sbjct: 1703 CPPKC-CTSQLSKDRQKECKESCPKVCGPGCPVQCCSDLNICPANCTGSACKPGCITIED 1761 Query: 361 RFDCS--KPKPCEEGCACKPDYLKLDDNSACVKICE---CPQMASS---PDCPKL*CK 212 S K C E C K L ++ C+K CP+ + PDCP + CK Sbjct: 1762 SVTVSLGNDKLCPEACLTK--CLPSCPSTCCIKNSPPVVCPKSCETTCTPDCPVMCCK 1817 Score = 29.1 bits (62), Expect = 2.5 Identities = 29/98 (29%), Positives = 38/98 (38%), Gaps = 10/98 (10%) Frame = -3 Query: 457 ENCPN*ECSG--ENEEFTNCTNPCPPRTCNSLVARF--DCSKPKPCEEGC--ACKPDYLK 296 E CP C E ++C CPPR C +++ + S + C C CKP+ Sbjct: 1184 EGCPEQCCQNGCPVECLSSCKPHCPPRCCFTVLIPIADNQSVKEKCPAVCKETCKPEC-- 1241 Query: 295 LDDNSACVKICE-CPQMA---SSPDCPKL*CKVKLKII 194 S C+K CP P CP C LK I Sbjct: 1242 --PLSCCLKDARGCPATCVEDCKPGCPPECCFAVLKPI 1277 Score = 27.5 bits (58), Expect = 7.5 Identities = 34/129 (26%), Positives = 47/129 (36%), Gaps = 20/129 (15%) Frame = -3 Query: 541 SVDQKSCKAGCV--CKEGYLKDDSGKCVARE---NCPN*EC----SGENEEFTNCTNPCP 389 +V +SCK C C L C CP C +G++ +C + C Sbjct: 1348 AVCSESCKPDCPIKCCSNALSSCPQSCSGDHCGAECPTQCCLLADNGQHSSTASCPSACS 1407 Query: 388 PRTCN-SLVARFDCSKPKPCEE----GCACKPDYLKLDDNSACVKIC--ECPQ--MASS- 239 P CN AR + +P E C + + VK C ECP + S+ Sbjct: 1408 PSGCNPDCPARCCITVLQPLNEKHNTTAECPSECSETCKPECPVKCCTGECPAGCLPSNC 1467 Query: 238 -PDCPKL*C 215 PDCP C Sbjct: 1468 KPDCPSKCC 1476 >SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 441 Score = 32.3 bits (70), Expect = 0.26 Identities = 30/108 (27%), Positives = 40/108 (37%), Gaps = 1/108 (0%) Frame = -3 Query: 529 KSCKAGCVCKEGYLKDDSGKCVARENCPN*ECSGENEEFTNCTNPCPPRTCNSLVARFDC 350 + CK G C A +CPN C G TNCT C + C +V C Sbjct: 181 QECKTGS-CSFNCAAQTCESSCAHGSCPNMTCGG-----TNCTQKC-GKDCQQVV----C 229 Query: 349 SKPKPCEEGCACKPDYLKLDDNS-ACVKICECPQMASSPDCPKL*CKV 209 S C++ C + L + + C + C Q A DC C V Sbjct: 230 SASGKCDQSCDGEGCNLYCSEGAKTCNQKC---QGACVTDCKSRWCGV 274 >SB_47942| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 2195 Score = 31.9 bits (69), Expect = 0.35 Identities = 21/72 (29%), Positives = 30/72 (41%), Gaps = 4/72 (5%) Frame = -3 Query: 433 SGENEEFTNCTNPCPP---RTCNSLVARFDCSKPKPCEE-GCACKPDYLKLDDNSACVKI 266 +G NCTNP P RTC+ L R + +PC C Y + + S C K Sbjct: 401 NGTRTRIRNCTNPPPKHNGRTCDVLGPRIE---TQPCNTFYCPVDGGYTQWSEYSQCSKT 457 Query: 265 CECPQMASSPDC 230 C + + +C Sbjct: 458 CGLGEAFRTRNC 469 >SB_17530| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 165 Score = 31.9 bits (69), Expect = 0.35 Identities = 24/82 (29%), Positives = 33/82 (40%), Gaps = 2/82 (2%) Frame = -3 Query: 511 CVCKEGYLKDDSGKCVARENCPN*ECSGENEEFTN--CTNPCPPRTCNSLVARFDCSKPK 338 C C EGY ++ GKC C +G+++ N CTN C L R K Sbjct: 27 CQCAEGYERNSQGKCADVNECK----TGKHDCSVNALCTNTDGTFICRCL--RGYIGDGK 80 Query: 337 PCEEGCACKPDYLKLDDNSACV 272 C + CK D N+ C+ Sbjct: 81 TCIDFDECKLPKNDCDVNAECI 102 >SB_11257| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.7e-11) Length = 3810 Score = 31.5 bits (68), Expect = 0.46 Identities = 24/89 (26%), Positives = 32/89 (35%) Frame = -3 Query: 505 CKEGYLKDDSGKCVARENCPN*ECSGENEEFTNCTNPCPPRTCNSLVARFDCSKPKPCEE 326 C EGY + + CP+ N T NPCP T N L AR + C Sbjct: 1042 CMEGYYCPGANSEYSSRPCPSGYYC-PNGTATPYQNPCPAGTFNPLQARTGFKDCEGCSA 1100 Query: 325 GCACKPDYLKLDDNSACVKICECPQMASS 239 G C + N C C + ++S Sbjct: 1101 GMYCAVQGMS-QPNGTCAAGYYCRRNSTS 1128 Score = 31.5 bits (68), Expect = 0.46 Identities = 22/73 (30%), Positives = 31/73 (42%) Frame = -3 Query: 529 KSCKAGCVCKEGYLKDDSGKCVARENCPN*ECSGENEEFTNCTNPCPPRTCNSLVARFDC 350 KSC+ G C G + ++ C + CP G E T+ PCP T N L + + Sbjct: 1468 KSCEPGYYCLLGTVNFNNTVCPSGHYCP-----GGTE--TSTQYPCPAGTYNRLAGQTND 1520 Query: 349 SKPKPCEEGCACK 311 S C G C+ Sbjct: 1521 SSCVNCTAGKYCE 1533 Score = 30.3 bits (65), Expect = 1.1 Identities = 33/108 (30%), Positives = 40/108 (37%), Gaps = 9/108 (8%) Frame = -3 Query: 523 CKAGCVCKEGY---LKDDSGK---CVARENCPN*ECSGENEEFTNCTNPCPPRTCNSLVA 362 C G C++G D GK C A CP T+ PCP T ++ Sbjct: 2333 CGPGYFCRQGANMTTPDLPGKAEICPAGSYCPEGHYCMMG---THHPEPCPSGTFSNGTQ 2389 Query: 361 RFDCSKPKPCEEGCACKPDYLKLDDNSACVKICECP--QMASSP-DCP 227 D SK PC EG C L + C CP Q S+P CP Sbjct: 2390 LIDSSKCIPCREGWYCDSTGL-VQPKDECDPGFFCPEGQNKSNPYPCP 2436 Score = 28.3 bits (60), Expect = 4.3 Identities = 20/73 (27%), Positives = 28/73 (38%), Gaps = 1/73 (1%) Frame = -3 Query: 526 SCKAGCVCKEGYLKDDSGKCVARENCPN*E-CSGENEEFTNCTNPCPPRTCNSLVARFDC 350 +C AG C G + V CP C +++ T PCPP T ++ Sbjct: 467 NCSAGFYCISGAKVPNPTDGVTGNVCPAGSYCPSKSQMHT----PCPPGTFSNSTQNTAL 522 Query: 349 SKPKPCEEGCACK 311 S C EG C+ Sbjct: 523 SDCNDCTEGYYCE 535 Score = 28.3 bits (60), Expect = 4.3 Identities = 21/87 (24%), Positives = 33/87 (37%) Frame = -3 Query: 523 CKAGCVCKEGYLKDDSGKCVARENCPN*ECSGENEEFTNCTNPCPPRTCNSLVARFDCSK 344 C+AG C EG +++ C +CP +G CP T + C Sbjct: 1794 CRAGFYCPEGSQDENAVPCTIGLHCP----TGSKTPI-----DCPEGTFTNTTTSPSC-- 1842 Query: 343 PKPCEEGCACKPDYLKLDDNSACVKIC 263 + C EG C P+ + D ++ C Sbjct: 1843 -QDCPEGFYCVPENVTSGDPTSGYHTC 1868 Score = 27.9 bits (59), Expect = 5.7 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = -3 Query: 535 DQKSCKAGCVCKEGYLKDDSGKCVARENCPN*ECSGENEEFTNCT 401 D +C AG C L +G C R CP + EF NCT Sbjct: 818 DCYNCTAGYYCDAEGLTRVAGPCAERYYCPGANTRPDPPEF-NCT 861 >SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) Length = 3369 Score = 31.5 bits (68), Expect = 0.46 Identities = 28/91 (30%), Positives = 37/91 (40%), Gaps = 11/91 (12%) Frame = -3 Query: 511 CVCKEGY--LKDDSGKCVARENCPN*ECSGENEEFTNCTNPCPPRTCNSLVARF------ 356 C CK+G + + GKC +CP G +F N CPP C A Sbjct: 3189 CECKDGETGVLAEDGKC----DCPPKCDDGRKPKFVNNRWKCPPPECGEHPACVTGRKGE 3244 Query: 355 DCSKP--KPCEEGCACKPDYLKLDD-NSACV 272 CS+P PC+ C+ + L D S CV Sbjct: 3245 GCSQPDVTPCDSSCSGNGIPVVLGDCGSRCV 3275 >SB_8177| Best HMM Match : TSP_1 (HMM E-Value=6e-38) Length = 950 Score = 31.5 bits (68), Expect = 0.46 Identities = 17/56 (30%), Positives = 25/56 (44%) Frame = -3 Query: 427 ENEEFTNCTNPCPPRTCNSLVARFDCSKPKPCEEGCACKPDYLKLDDNSACVKICE 260 E +++ C NPC N C+ P P +G CK DYL+ C+ C+ Sbjct: 80 EWSQWSLCDNPCGGSVVNRTRT---CTNPTPTPDGKPCKGDYLQ--TKLECIAPCK 130 Score = 28.3 bits (60), Expect = 4.3 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = -3 Query: 415 FTNCTNPCPPRTCNSLVARFDCSKPKPCEEGCACKPDYLKLDDNSACVKIC 263 +T+CT C T +R DC+ P+P G C DY++ S +K+C Sbjct: 240 WTSCTKTCG--TGMQKRSR-DCTNPRPIHGGQNCTGDYVQ--TKSCKLKVC 285 >SB_55808| Best HMM Match : Pentaxin (HMM E-Value=1.2e-08) Length = 574 Score = 31.1 bits (67), Expect = 0.61 Identities = 19/44 (43%), Positives = 22/44 (50%) Frame = +1 Query: 388 ADMGSCSW*TLHFRLNIPNLGNFLGRHIYRYRLLDIPLYTRIRL 519 A++ C W FR P GN LG H+Y Y D P TRI L Sbjct: 71 AELTICVW----FRTR-PQAGNVLGGHLYFYHTGDHPDQTRIAL 109 >SB_45116| Best HMM Match : EGF (HMM E-Value=0) Length = 2023 Score = 31.1 bits (67), Expect = 0.61 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = -3 Query: 403 TNPC-PPRTCNSLVARFDCSKPKPCEEGCACKPDYLKLDDNSACVKICECPQMASSPDC 230 +NPC TCN LV ++C+ P P G C+ D + N CV C + + +C Sbjct: 282 SNPCLNGGTCNDLVNGYNCNCP-PGYNGTTCEIDINECASN-PCVNGGTCADLVNGFNC 338 >SB_18624| Best HMM Match : EGF (HMM E-Value=7.8e-06) Length = 382 Score = 30.7 bits (66), Expect = 0.80 Identities = 18/58 (31%), Positives = 20/58 (34%) Frame = -3 Query: 397 PCPPRTCNSLVARFDCSKPKPCEEGCACKPDYLKLDDNSACVKICECPQMASSPDCPK 224 P N V R C KPC G C D+ +C CP AS C K Sbjct: 109 PSASYLANPSVCRNGCCLSKPCLNGGTCTEKC----DHPKTKFVCNCPANASGKQCEK 162 >SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2680 Score = 30.3 bits (65), Expect = 1.1 Identities = 19/86 (22%), Positives = 36/86 (41%), Gaps = 2/86 (2%) Frame = -3 Query: 508 VCKEGYLKDDSGKCVARENCPN*ECSGENEEFTNCTNPCPPRTCNSLVARFDCSKPKPCE 329 VC++ + ++ A + C +C+G E + T + + +C + Sbjct: 477 VCRDDFFREPGKSLSAVDVCSPCQCTGPGVETGKTSCARDDSTPGVIAGQCECKQYTQGR 536 Query: 328 EGCACKPDY--LKLDDNSACVKICEC 257 + ACKP + LK ++ CV C C Sbjct: 537 QCDACKPGFYDLKSSHSTGCV-TCGC 561 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 30.3 bits (65), Expect = 1.1 Identities = 28/109 (25%), Positives = 42/109 (38%), Gaps = 15/109 (13%) Frame = -3 Query: 511 CVCKEGYLKDDSG---------KCVARENCPN*ECSGEN--EEFTNC-TNPCP-PRTCNS 371 C CKEGY D G C+ C + +G N E C ++PC TC Sbjct: 1436 CTCKEGYTGKDCGTDIDECSSNPCLNEGTCTDQGYTGPNCEVEVNECQSDPCQNGGTCED 1495 Query: 370 LVARFDCSKPKPCEEGCACKPDYLKLDD--NSACVKICECPQMASSPDC 230 L+A + C C+ G + +D+ +S C C + + C Sbjct: 1496 LIASYRCF----CKAGYTGRHCETDIDECASSPCANGGTCTDLVDAHKC 1540 >SB_55657| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 868 Score = 30.3 bits (65), Expect = 1.1 Identities = 22/94 (23%), Positives = 36/94 (38%) Frame = -3 Query: 511 CVCKEGYLKDDSGKCVARENCPN*ECSGENEEFTNCTNPCPPRTCNSLVARFDCSKPKPC 332 C CK GY D KC + + ++ + C P C+ + CS Sbjct: 322 CTCKPGYKGDPKVKCEGDGDGDGDDDDDDDGDINECNY---PNDCSQM-----CSNTAGS 373 Query: 331 EEGCACKPDYLKLDDNSACVKICECPQMASSPDC 230 + C+C ++ +D C I EC ++ DC Sbjct: 374 YK-CSCVNGFVLSNDLKTCADINECATPVTN-DC 405 Score = 29.5 bits (63), Expect = 1.9 Identities = 22/84 (26%), Positives = 32/84 (38%), Gaps = 5/84 (5%) Frame = -3 Query: 511 CVCKEGYLKDDSGKCVARENCPN*ECSGENEEFTNCTNPCPPRTCNSLVARFDCSKPKPC 332 C C+ GY+ ++G+ C+ T+ NP C+ ++ DC C Sbjct: 268 CKCRPGYISSNNGRI----------CT----VVTSSMNPLDINECDPILGSNDCGANTDC 313 Query: 331 EEG-----CACKPDYLKLDDNSAC 275 G C CKP Y K D C Sbjct: 314 TNGPGNYSCTCKPGY-KGDPKVKC 336 Score = 27.1 bits (57), Expect = 9.9 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = -3 Query: 322 CACKPDYLKLDDNSACVKICECPQMASSPDCP 227 C C P Y + D C + EC A CP Sbjct: 538 CGCPPGYKLMSDEKTCQDVDECENAAQL--CP 567 >SB_52882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1413 Score = 29.9 bits (64), Expect = 1.4 Identities = 16/50 (32%), Positives = 21/50 (42%) Frame = -3 Query: 352 CSKPKPCEEGCACKPDYLKLDDNSACVKICECPQMASSPDCPKL*CKVKL 203 C C+ G C DY K+D C+C DC +L C+V L Sbjct: 163 CKDVTRCKNGGTCVNDYNKIDGY-----YCDCAPDFGGLDCGELKCRVSL 207 >SB_48384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1678 Score = 29.9 bits (64), Expect = 1.4 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -3 Query: 511 CVCKEGYLKDDSGKCVARENCPN*E--CSGEN 422 C CK GY +DS CV C CSG N Sbjct: 811 CSCKRGYAHNDSNVCVDVNECTETPYVCSGNN 842 >SB_10656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1931 Score = 29.9 bits (64), Expect = 1.4 Identities = 23/92 (25%), Positives = 35/92 (38%) Frame = -3 Query: 505 CKEGYLKDDSGKCVARENCPN*ECSGENEEFTNCTNPCPPRTCNSLVARFDCSKPKPCEE 326 C++GY G V +NC ECS + C + C + V +CS Sbjct: 1211 CRDGYY----GDAVVAKNCAKCECSACGAVTSVCNHTNGACQCKANVIGPNCS------- 1259 Query: 325 GCACKPDYLKLDDNSACVKICECPQMASSPDC 230 CKP+ + C + CEC + + C Sbjct: 1260 --TCKPNTWNFNSCLGC-EDCECAEASLGQSC 1288 >SB_10244| Best HMM Match : Laminin_EGF (HMM E-Value=0) Length = 205 Score = 29.9 bits (64), Expect = 1.4 Identities = 26/97 (26%), Positives = 37/97 (38%), Gaps = 18/97 (18%) Frame = -3 Query: 511 CVCKEGYLKDDSGKC------VARENCPN*ECSGENEEFTNCTNPCPPRTCNSLVARFDC 350 C CK G D G+C + E C +C+ + C + +C + V DC Sbjct: 82 CRCKPGVEGRDCGRCKPGFYNMTSEGCRPCDCNVNGSSSSLCDHVTGQCSCKANVVGRDC 141 Query: 349 SK---------PKPCEEGCACK---PDYLKLDDNSAC 275 S+ P C E CAC L+ DD+ C Sbjct: 142 SRCKVSSYGFGPAGCTE-CACNVHGSASLQCDDSGVC 177 >SB_52861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1487 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = -3 Query: 511 CVCKEGYLKDDSGKC--VARENCPN*ECS 431 CVCK GY + SG+C V + C N +C+ Sbjct: 218 CVCKPGYEQALSGQCVPVCTQGCVNGKCT 246 >SB_45709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1112 Score = 29.5 bits (63), Expect = 1.9 Identities = 21/80 (26%), Positives = 31/80 (38%), Gaps = 9/80 (11%) Frame = -3 Query: 535 DQKSCKAGCVCKEGYLKDDSGKCVARE-NCP-N*ECSGENEEFTNCTN-PCPPR--TC-- 377 D+ CK C + D G+C+ C +C+ ++E C N C P TC Sbjct: 373 DESGCKPTTTCSANEFRCDDGRCITSTFRCDREFDCTDRSDE-RGCVNKTCAPYEFTCAF 431 Query: 376 --NSLVARFDCSKPKPCEEG 323 + RF C C +G Sbjct: 432 SGRCIPGRFRCDHRSDCLDG 451 >SB_5000| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 1050 Score = 29.5 bits (63), Expect = 1.9 Identities = 22/84 (26%), Positives = 32/84 (38%), Gaps = 5/84 (5%) Frame = -3 Query: 511 CVCKEGYLKDDSGKCVARENCPN*ECSGENEEFTNCTNPCPPRTCNSLVARFDCSKPKPC 332 C C+ GY+ ++G+ C+ T+ NP C+ ++ DC C Sbjct: 442 CKCRPGYISSNNGRI----------CT----VVTSSMNPLDINECDPILGSNDCGANTDC 487 Query: 331 EEG-----CACKPDYLKLDDNSAC 275 G C CKP Y K D C Sbjct: 488 TNGPGNYSCTCKPGY-KGDPKVKC 510 Score = 27.1 bits (57), Expect = 9.9 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = -3 Query: 322 CACKPDYLKLDDNSACVKICECPQMASSPDCP 227 C C P Y + D C + EC A CP Sbjct: 763 CGCPPGYKLMSDEKTCQDVDECENAAQL--CP 792 >SB_52240| Best HMM Match : DUF1700 (HMM E-Value=4.1) Length = 254 Score = 29.5 bits (63), Expect = 1.9 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -3 Query: 337 PCEEGCACKPDYLKLDDNSACVK 269 PC EG +C+PD L DD +C + Sbjct: 83 PCSEGYSCRPD-LNKDDTYSCTR 104 >SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) Length = 960 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/46 (28%), Positives = 19/46 (41%) Frame = -3 Query: 526 SCKAGCVCKEGYLKDDSGKCVARENCPN*ECSGENEEFTNCTNPCP 389 +C + C C G +G CV C ++ NC +PCP Sbjct: 502 NCSSKCDCINGSCDPVTGACVCNRRVTGQRC---DKPCINCNSPCP 544 Score = 29.1 bits (62), Expect = 2.5 Identities = 29/118 (24%), Positives = 41/118 (34%), Gaps = 18/118 (15%) Frame = -3 Query: 529 KSCKAGCVCKEGYLKDDSGKCVARENCPN*ECSGENEEFT---NCTNPCP--PRTCNSLV 365 + C++ C C GY +G C C T NCT PC +CN+ Sbjct: 582 RQCQSKCQCLHGYCDHVTGSCECLPGWTGKRCDQACPSGTYGFNCTLPCACVNGSCNATD 641 Query: 364 ARFDCSK-------PKPC---EEGCACKPDYLKLDDNSACVKI---CECPQMASSPDC 230 +C+ +PC + G C L +N C I C C + P C Sbjct: 642 GSCNCAAGYHGNACDRPCPAGKHGANCGLKCL-CANNGTCNAITGRCSCGTGWTGPSC 698 >SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 29.5 bits (63), Expect = 1.9 Identities = 25/80 (31%), Positives = 33/80 (41%), Gaps = 3/80 (3%) Frame = -3 Query: 493 YLKDDSGKCVARENCPN*ECS-GENEEFTNCT--NPCPPRTCNSLVARFDCSKPKPCEEG 323 ++ D KC E C +CS G + T C NPC R C P + Sbjct: 214 HIVDVQTKCDT-EQC---KCSEGFQGKGTACLPINPCHEANQGGCEGRAICVYTGPGKSI 269 Query: 322 CACKPDYLKLDDNSACVKIC 263 C C P Y KLD++ A +C Sbjct: 270 CKCPPGY-KLDESQARCTLC 288 >SB_44830| Best HMM Match : I-set (HMM E-Value=1.1e-08) Length = 480 Score = 29.1 bits (62), Expect = 2.5 Identities = 21/61 (34%), Positives = 25/61 (40%) Frame = +3 Query: 204 NLTLHYNFGQSGELAICGHSQILTQAELSSSFK*SGLQAHPSSQGLGLLQSKRATSELQV 383 NLT H G + CG Q+ T ELS F + P S L + T E QV Sbjct: 30 NLTWHLFVGLAVYHRRCGMRQVQTLPELSRIFLAPTNERRPFSSALVSQMQRLMTQEYQV 89 Query: 384 R 386 R Sbjct: 90 R 90 >SB_48688| Best HMM Match : Ldl_recept_a (HMM E-Value=7.8e-26) Length = 351 Score = 29.1 bits (62), Expect = 2.5 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 6/74 (8%) Frame = -3 Query: 526 SCKAGCVCKEGYLKDDSGKCVARENCPN*E--CSGENEEFTNCTNPCPPR-TC---NSLV 365 S + C C+ K GKCV N E C+ ++E+ +C N C R C + Sbjct: 67 SDERNCACRSAEFKCPDGKCVHPSKFCNGESDCTDGSDEW-SCDNSCSSRHACADGTCVT 125 Query: 364 ARFDCSKPKPCEEG 323 C+ C++G Sbjct: 126 WSLTCNGVSDCQDG 139 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 29.1 bits (62), Expect = 2.5 Identities = 19/77 (24%), Positives = 30/77 (38%), Gaps = 2/77 (2%) Frame = -3 Query: 481 DSGKCVARENCPN*ECSGENEEFTNC--TNPCPPRTCNSLVARFDCSKPKPCEEGCACKP 308 + G CV +EN C N E +C NPC P C + + + C G + Sbjct: 324 NGGTCVPQENGYRCTCQA-NYEGNDCERANPCSPNPCRNGGTCSEMNNAAVCACGVQFEG 382 Query: 307 DYLKLDDNSACVKICEC 257 + ++D + C C Sbjct: 383 NQCEIDKCAKCDMHATC 399 Score = 28.3 bits (60), Expect = 4.3 Identities = 23/81 (28%), Positives = 28/81 (34%), Gaps = 3/81 (3%) Frame = -3 Query: 541 SVDQKSCKAGCVCKEGYLKDDS--GKCVAREN-CPN*ECSGENEEFTNCTNPCPPRTCNS 371 SV+ CVCK+GY D K V N C N + +C C Sbjct: 252 SVNADCILGHCVCKDGYHGDGKTCNKNVCHPNPCHNGATCVATDSSFDC--DCVAGWTGP 309 Query: 370 LVARFDCSKPKPCEEGCACKP 308 L P PC+ G C P Sbjct: 310 LCQTRQYCIPNPCQNGGTCVP 330 >SB_30577| Best HMM Match : Ldl_recept_a (HMM E-Value=2.8e-25) Length = 147 Score = 29.1 bits (62), Expect = 2.5 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 6/74 (8%) Frame = -3 Query: 526 SCKAGCVCKEGYLKDDSGKCVARENCPN*E--CSGENEEFTNCTNPCPPR-TC---NSLV 365 S + C C+ K GKCV N E C+ ++E+ +C N C R C + Sbjct: 67 SDERNCACRSAEFKCPDGKCVHPSKFCNGESDCTDGSDEW-SCDNSCSSRHACADGTCVT 125 Query: 364 ARFDCSKPKPCEEG 323 C+ C++G Sbjct: 126 WSLTCNGVSDCQDG 139 >SB_6077| Best HMM Match : EGF (HMM E-Value=0) Length = 1165 Score = 29.1 bits (62), Expect = 2.5 Identities = 19/67 (28%), Positives = 26/67 (38%), Gaps = 10/67 (14%) Frame = -3 Query: 400 NPCPPRTCNSLVARFDCSKP-----KPCEEGCACKPDYL-----KLDDNSACVKICECPQ 251 NPC TC LV + C P + C + YL N++ CECP+ Sbjct: 488 NPCHNGTCEDLVNNYKCVCPDNRQERTCAGNSSVCDTYLCRNGGSCFSNNSTYYTCECPK 547 Query: 250 MASSPDC 230 + DC Sbjct: 548 GYTGHDC 554 >SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5445 Score = 28.7 bits (61), Expect = 3.2 Identities = 23/80 (28%), Positives = 32/80 (40%) Frame = -3 Query: 511 CVCKEGYLKDDSGKCVARENCPN*ECSGENEEFTNCTNPCPPRTCNSLVARFDCSKPKPC 332 C C GY+ + + +NC N CSG NC + CN D S K C Sbjct: 2643 CECFVGYIGKECENVSSVDNCGNQTCSGRG----NCISQVSSYLCNCTT---DYS-GKDC 2694 Query: 331 EEGCACKPDYLKLDDNSACV 272 + C D + L D S+ + Sbjct: 2695 LQLCRQYFDIIFLVDGSSSI 2714 >SB_52147| Best HMM Match : EGF (HMM E-Value=0) Length = 364 Score = 28.7 bits (61), Expect = 3.2 Identities = 19/68 (27%), Positives = 26/68 (38%), Gaps = 5/68 (7%) Frame = -3 Query: 511 CVCKEGYLKDDS----GKCVARENCPN*ECSGENEEF-TNCTNPCPPRTCNSLVARFDCS 347 CVC EGY D C++ C N C + +C N C +L+ D Sbjct: 82 CVCSEGYTGDRCETVVDMCISAP-CHNGTCINYGSSYICDCFNSYTGHLCETLI---DAC 137 Query: 346 KPKPCEEG 323 PC +G Sbjct: 138 HSNPCNDG 145 >SB_51898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1712 Score = 28.7 bits (61), Expect = 3.2 Identities = 31/116 (26%), Positives = 49/116 (42%), Gaps = 15/116 (12%) Frame = -3 Query: 535 DQKSCKAGCVCKEGYLKDDSGK--CVARE-NCPN-*ECSGENEEFTNCTNPCPP---RTC 377 D+K+C CK Y+ S K C+ + C +C+ +++E +C PC R Sbjct: 1297 DEKNCGEPSTCKPNYISCASMKAICIPKMWRCDGMLDCTDKSDE-EDCP-PCKENQFRCD 1354 Query: 376 NSLVARFD--CSKPKPC-----EEGCA-CKPDYLKLDDNSACVKICECPQMASSPD 233 N D C K K C E GCA C+P++ + + +C Q+ D Sbjct: 1355 NGQCIDGDPRCDKYKNCTDGSDELGCATCEPNFFRCNTGKCISARWQCDQLDDCGD 1410 >SB_33986| Best HMM Match : EGF_CA (HMM E-Value=3.5e-17) Length = 85 Score = 28.7 bits (61), Expect = 3.2 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -3 Query: 322 CACKPDYLKLDDNSACVKICECPQMASSPDCP 227 C C+P + LDD C + EC S CP Sbjct: 24 CICRPGFYLLDDERTCEDLDEC--SLPSTKCP 53 >SB_51974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3474 Score = 28.3 bits (60), Expect = 4.3 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 322 CACKPDYLKLDDNSACVKICEC 257 C+C P ++ DN C+ I EC Sbjct: 732 CSCNPGFVLASDNFGCLDINEC 753 Score = 28.3 bits (60), Expect = 4.3 Identities = 14/53 (26%), Positives = 26/53 (49%) Frame = -3 Query: 379 CNSLVARFDCSKPKPCEEGCACKPDYLKLDDNSACVKICECPQMASSPDCPKL 221 C + V +C+ P C+C P Y + N +C+ + EC S+ +C ++ Sbjct: 835 CATKVCSHNCTNT-PGSYRCSCFPGYQQGPKNDSCLDVDEC--STSTHNCTQI 884 Score = 27.9 bits (59), Expect = 5.7 Identities = 28/100 (28%), Positives = 38/100 (38%), Gaps = 15/100 (15%) Frame = -3 Query: 511 CVCKEGY-LKDDSGKCVARENCP------N*ECSGENEEFTNCTNPCPPRTC-------- 377 C C GY L D CV + C N C+ FT C+ C R C Sbjct: 535 CSCWTGYILGSDYKSCVDVDECSSGIAQCNQTCANIPGSFT-CS--CDQRNCLDIDECSS 591 Query: 376 NSLVARFDCSKPKPCEEGCACKPDYLKLDDNSACVKICEC 257 N + C+ P C C P + + ++ +CV I EC Sbjct: 592 NLHICNQTCNNV-PGSYYCTCFPGFYLMMEDQSCVDIDEC 630 Score = 27.5 bits (58), Expect = 7.5 Identities = 23/88 (26%), Positives = 31/88 (35%), Gaps = 3/88 (3%) Frame = -3 Query: 511 CVCKEGYLKDDSGKCVARENCPN*ECSGENEEFTNCTNPCPPRTCNSLVARFDCSKP--- 341 C C +DD+ P + NE T+ C S+V RF CS Sbjct: 315 CSCSNQTSEDDTASSGGSMASPGFNLTTSNETETSSGESVDG--CYSVVQRF-CSHQCLN 371 Query: 340 KPCEEGCACKPDYLKLDDNSACVKICEC 257 P C C +D +CV + EC Sbjct: 372 TPGSFICTCPEGLALSEDGKSCVDVDEC 399 Score = 27.1 bits (57), Expect = 9.9 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -3 Query: 322 CACKPDYLKLDDNSACVKICECPQMASSPDC 230 C C Y LDD +C I EC S +C Sbjct: 814 CGCHQGYNLLDDLISCGDIDECATKVCSHNC 844 >SB_47927| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) Length = 512 Score = 28.3 bits (60), Expect = 4.3 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = -3 Query: 385 RTCN-SLVARF-DCSKPKPCEEGCACKPDYLKLDDNSACVKICE 260 +TC ++V R +C+ P+P G C+P K + C K CE Sbjct: 226 KTCGGAVVTRTRECNSPEPSNGGKPCEPSDAK-ETKEDCTKPCE 268 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 28.3 bits (60), Expect = 4.3 Identities = 17/63 (26%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Frame = -3 Query: 355 DCSKPKPCEEGCACKPDYLKLDDNSACVKICECPQMASSPDCPKL*CKVK-LKIIWISKT 179 +CS PC G C D A ++C+CP+ P C + + IW+ K Sbjct: 2822 NCSNENPCLNGGTCH------DTVPAGWRVCQCPRGYRGPHCEQTTRTFRGTSYIWLPKL 2875 Query: 178 LFY 170 Y Sbjct: 2876 TAY 2878 >SB_12832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1169 Score = 28.3 bits (60), Expect = 4.3 Identities = 16/62 (25%), Positives = 26/62 (41%), Gaps = 2/62 (3%) Frame = -3 Query: 406 CTNPCPPRTCNS-LVARFDCSKPKPCEEGCACKPDYLKLDDNSACVKICECPQ-MASSPD 233 C P R C+S + + C EG CK + + ++C K CP+ + + Sbjct: 835 CQVCLPGRYCDSDTTTETNMNTTMRCPEGLYCKGGLTNVSEATSCSKAHYCPEGIEAEVP 894 Query: 232 CP 227 CP Sbjct: 895 CP 896 >SB_55591| Best HMM Match : TIL (HMM E-Value=4.2e-09) Length = 133 Score = 28.3 bits (60), Expect = 4.3 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -3 Query: 523 CKAGCVCKEGYLKDDSGKCVARENC 449 C GC C EG ++ D GKCV C Sbjct: 88 CVDGCFCPEGKIQ-DRGKCVDPGQC 111 >SB_52794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1408 Score = 28.3 bits (60), Expect = 4.3 Identities = 27/105 (25%), Positives = 41/105 (39%), Gaps = 3/105 (2%) Frame = -3 Query: 535 DQKSCKAGCV---CKEGYLKDDSGKCVARENCPN*ECSGENEEFTNCTNPCPPRTCNSLV 365 ++K+C AG C+ + S C + C G N C R C++ + Sbjct: 421 NRKACDAGFTGDYCEINIDECASAPCHSYSTC----LDGVNNYTCLCGPRWTGRDCSTNL 476 Query: 364 ARFDCSKPKPCEEGCACKPDYLKLDDNSACVKICECPQMASSPDC 230 C P PC+ G CK + D N + C CPQ + +C Sbjct: 477 GNL-CD-PNPCQNGGVCKETF---DRN---IYTCACPQGYTGWNC 513 >SB_39250| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) Length = 468 Score = 28.3 bits (60), Expect = 4.3 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = -3 Query: 385 RTCN-SLVARF-DCSKPKPCEEGCACKPDYLKLDDNSACVKICE 260 +TC ++V R +C+ P+P G C+P K + C K CE Sbjct: 182 KTCGGAVVTRTRECNSPEPSNGGKPCEPSDAK-ETKEDCTKPCE 224 >SB_22765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1387 Score = 28.3 bits (60), Expect = 4.3 Identities = 20/57 (35%), Positives = 23/57 (40%), Gaps = 4/57 (7%) Frame = -3 Query: 529 KSCKAGCVCKEGYLKDDSG----KCVARENCPN*ECSGENEEFTNCTNPCPPRTCNS 371 KSC A C G K AR+ CP C + CTN CPP C+S Sbjct: 987 KSCPAHCCLGPGKSMSSKQLEILKTFARKFCPE-SCRAK------CTNSCPPICCDS 1036 >SB_32719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 604 Score = 27.9 bits (59), Expect = 5.7 Identities = 23/89 (25%), Positives = 27/89 (30%), Gaps = 3/89 (3%) Frame = -3 Query: 511 CVCKEGYLKDDSGKCVARENCPN*ECSGE---NEEFTNCTNPCPPRTCNSLVARFDCSKP 341 C CKEGYL C C C + + CP D P Sbjct: 293 CHCKEGYL---GSHCEQMNFCYGNPCKNKGTCTPKLDGYECDCPEGFYGKNCDGVDRCYP 349 Query: 340 KPCEEGCACKPDYLKLDDNSACVKICECP 254 PC G C N+ IC+CP Sbjct: 350 NPCANGATC--------FNAELTYICQCP 370 >SB_26085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 484 Score = 27.9 bits (59), Expect = 5.7 Identities = 13/27 (48%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -3 Query: 535 DQKSCKAGCVCKEGYLKDDS-GKCVAR 458 D S C CKEGY+ D S G CV + Sbjct: 458 DNTSGSYECYCKEGYVGDGSIGNCVRK 484 >SB_11375| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 651 Score = 27.9 bits (59), Expect = 5.7 Identities = 25/105 (23%), Positives = 38/105 (36%), Gaps = 17/105 (16%) Frame = -3 Query: 511 CVCKEGY-LKDDSGKCVARENC--PN*ECSGENEEFTNCTNPCPPRTCNSLVARFDC--- 350 C C+ GY L+ D+ C C N CS + N ++C Sbjct: 86 CSCRHGYALQADNTTCADINECVTSNGNCSHTCVNWEGGFNCTCAEGYALTYGGYECVDI 145 Query: 349 --SKPKPCEEGC---------ACKPDYLKLDDNSACVKICECPQM 248 KPC+ C +C+ + L DN+ C I EC ++ Sbjct: 146 DECSSKPCDHTCRNTNGSFVCSCREGFRLLSDNTTCRDIDECEEL 190 >SB_30923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 27.9 bits (59), Expect = 5.7 Identities = 22/87 (25%), Positives = 31/87 (35%), Gaps = 3/87 (3%) Frame = -3 Query: 511 CVCKEGYLKDDSGKCVARENCPN*EC--SGENEEFTNCTN-PCPPRTCNSLVARFDCSKP 341 C+C + Y D C R C + C G E CP ++ D P Sbjct: 21 CICPKDYRGKD---CQERNYCSSMPCLNGGSCVEIPGAFKCGCPFGFLGTVCEERDACHP 77 Query: 340 KPCEEGCACKPDYLKLDDNSACVKICE 260 PC+ G C + D S V +C+ Sbjct: 78 NPCKNGGTC----TRSDTESGFVCVCK 100 >SB_22953| Best HMM Match : EGF_2 (HMM E-Value=1.3e-14) Length = 635 Score = 27.9 bits (59), Expect = 5.7 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = -3 Query: 400 NPCPPRTCNSLVARFDCSKPKPCEEGCACKPDYLKLDDNSACVKIC 263 N CP C+ A+ C KP + C C P Y D +C + C Sbjct: 93 NSCPTPICSKGCAQGVCVKP----DNCTCHPGY----DGPSCDQAC 130 >SB_53569| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 921 Score = 27.5 bits (58), Expect = 7.5 Identities = 21/81 (25%), Positives = 31/81 (38%) Frame = -3 Query: 511 CVCKEGYLKDDSGKCVARENCPN*ECSGENEEFTNCTNPCPPRTCNSLVARFDCSKPKPC 332 C C +GY +CV + C + N N C +TCN+ + F C+ Sbjct: 586 CSCHQGYRLKGKHQCVDVDECSD-----------NSLNRCQ-QTCNNSIGSFKCT----- 628 Query: 331 EEGCACKPDYLKLDDNSACVK 269 C+P Y D +C K Sbjct: 629 -----CRPGYHLAIDGFSCTK 644 >SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) Length = 3037 Score = 27.5 bits (58), Expect = 7.5 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -3 Query: 271 KICECPQMASSPDCPKL*CKV 209 K+CE P+ +SS + P + CKV Sbjct: 220 KVCEQPEASSSVEMPNIECKV 240 >SB_18560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1937 Score = 27.5 bits (58), Expect = 7.5 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -3 Query: 511 CVCKEGYLKDDSGKCVARENCPN*EC 434 CVC GYL D KC A C +C Sbjct: 1224 CVCNPGYL-GDGRKCTADGTCEGVKC 1248 >SB_14155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 495 Score = 27.5 bits (58), Expect = 7.5 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -3 Query: 271 KICECPQMASSPDCPKL*CKV 209 K+CE P+ +SS + P + CKV Sbjct: 220 KVCEQPEASSSVEMPNIECKV 240 >SB_6771| Best HMM Match : Aldedh (HMM E-Value=0) Length = 523 Score = 27.5 bits (58), Expect = 7.5 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = +3 Query: 279 AELSSSFK*SGLQAHPSSQGLGLLQSKRATSELQVRGGHGFVQLVN 416 AEL+ ++ + A QG L Q K +++LQ RG GFV V+ Sbjct: 140 AELADFYRFAVHYAREMLQGPELHQPKGVSNKLQYRGLEGFVAAVS 185 >SB_18929| Best HMM Match : BRCT (HMM E-Value=1.4e-08) Length = 1213 Score = 27.1 bits (57), Expect = 9.9 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 11/54 (20%) Frame = -3 Query: 403 TNPCPPRTCNSLVARFDC---SKPKP---CEEGCA-----CKPDYLKLDDNSAC 275 + P PP+ C L C S+P P C C+ C+P L+L D AC Sbjct: 1063 SRPSPPQVCTFLRIAGVCMLVSRPSPPQECGHVCSRLTKRCRPPALRLRDKPAC 1116 >SB_6273| Best HMM Match : MAM (HMM E-Value=0) Length = 4272 Score = 27.1 bits (57), Expect = 9.9 Identities = 16/55 (29%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -3 Query: 415 FTNCTNPCPPRTCNSLVARFDCSKPKPCEEGCACKPDYL--KLDDNSACVKICEC 257 F NC P PP +C+S R D C + D + NS C C Sbjct: 2771 FDNCFQPDPPSSCSSNQFRCDSGHCISSSSKCDFETDCCDGSEERNSTCTAYTRC 2825 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,634,706 Number of Sequences: 59808 Number of extensions: 330063 Number of successful extensions: 1164 Number of sequences better than 10.0: 68 Number of HSP's better than 10.0 without gapping: 932 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1149 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1239956166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -