BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0575 (426 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 25 0.47 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.47 DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. 22 2.5 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 22 2.5 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 22 2.5 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 2.5 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 22 3.3 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 21 5.8 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 21 5.8 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 5.8 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 5.8 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 5.8 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 7.6 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 7.6 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 7.6 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 7.6 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 7.6 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 21 7.6 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 21 7.6 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 21 7.6 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 7.6 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 7.6 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 7.6 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 7.6 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 7.6 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 21 7.6 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 24.6 bits (51), Expect = 0.47 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 28 PRHHTTLFNYDRYLTEYEHDID 93 PRH + L N + +T++E D+D Sbjct: 175 PRHASDLDNCNHLMTKFEPDLD 196 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.6 bits (51), Expect = 0.47 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Frame = +2 Query: 245 FPNSCRPTLTPSRFTTTLSLPLR----GLRYPATVTCLSIARSTATPRALSMPTTT 400 F +SC P P S PL PAT+T + +T T A + TTT Sbjct: 75 FSSSCDPV--PGNLEQIGSRPLHPPASSTSLPATITTTTTTTTTTTATAAATATTT 128 >DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. Length = 132 Score = 22.2 bits (45), Expect = 2.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 239 LRRVGLYLSSALMSSEPFRERT 174 L++VG + + E FRERT Sbjct: 67 LKKVGFVNADTTFNEEKFRERT 88 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 2.5 Identities = 15/55 (27%), Positives = 26/55 (47%) Frame = +1 Query: 73 EYEHDIDRKMFKTHLDMIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPTRR 237 EY+ DR+ K H + E + + R+ +S R K ++ R +YR T + Sbjct: 11 EYKEK-DRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNEREYRKYRETSK 64 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 2.5 Identities = 15/55 (27%), Positives = 26/55 (47%) Frame = +1 Query: 73 EYEHDIDRKMFKTHLDMIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPTRR 237 EY+ DR+ K H + E + + R+ +S R K ++ R +YR T + Sbjct: 11 EYKEK-DRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNEREYRKYRETSK 64 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 22.2 bits (45), Expect = 2.5 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +3 Query: 174 RAFSKRFGRHQSRGKVQANTPQRFSRTPVDLP 269 +AF+++ + S GK+ A P FS P Sbjct: 337 KAFARKKTDYSSFGKILATEPTLFSNVTPKFP 368 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.8 bits (44), Expect = 3.3 Identities = 7/25 (28%), Positives = 13/25 (52%) Frame = +1 Query: 34 HHTTLFNYDRYLTEYEHDIDRKMFK 108 HH Y + EY+ D++ + +K Sbjct: 165 HHMDSVEYKPEIMEYKPDVEEQRYK 189 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.0 bits (42), Expect = 5.8 Identities = 14/55 (25%), Positives = 26/55 (47%) Frame = +1 Query: 73 EYEHDIDRKMFKTHLDMIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPTRR 237 EY+ DR+ K H + E + + R+ +S R K ++ + +YR T + Sbjct: 11 EYKEK-DRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSK 64 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 5.8 Identities = 14/55 (25%), Positives = 26/55 (47%) Frame = +1 Query: 73 EYEHDIDRKMFKTHLDMIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPTRR 237 EY+ DR+ K H + E + + R+ +S R K ++ + +YR T + Sbjct: 11 EYKEK-DRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSK 64 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.0 bits (42), Expect = 5.8 Identities = 14/55 (25%), Positives = 26/55 (47%) Frame = +1 Query: 73 EYEHDIDRKMFKTHLDMIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPTRR 237 EY+ DR+ K H + E + + R+ +S R K ++ + +YR T + Sbjct: 244 EYKEK-DRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSK 297 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 5.8 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = +1 Query: 91 DRKMFKTHLDMIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPTRRSVF 246 DR+ K H + E + R+ +S R K ++ R +YR T + F Sbjct: 249 DRQYEKLHNEKEKFLEERTSHKRYSRSREREQKSYKNEREYRKYRETSKERF 300 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.0 bits (42), Expect = 5.8 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 207 SRGKVQANTPQRFSRTPVDLP 269 SR + +AN +R P+++P Sbjct: 162 SRAREEANVVPEGARVPIEIP 182 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 20.6 bits (41), Expect = 7.6 Identities = 12/49 (24%), Positives = 23/49 (46%) Frame = +1 Query: 91 DRKMFKTHLDMIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPTRR 237 DR+ K H + E + + R+ +S R K ++ + +YR T + Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYRETSK 64 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 20.6 bits (41), Expect = 7.6 Identities = 12/49 (24%), Positives = 23/49 (46%) Frame = +1 Query: 91 DRKMFKTHLDMIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPTRR 237 DR+ K H + E + + R+ +S R K ++ + +YR T + Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYRETSK 64 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 20.6 bits (41), Expect = 7.6 Identities = 12/49 (24%), Positives = 23/49 (46%) Frame = +1 Query: 91 DRKMFKTHLDMIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPTRR 237 DR+ K H + E + + R+ +S R K ++ + +YR T + Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYRETSK 64 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 20.6 bits (41), Expect = 7.6 Identities = 12/49 (24%), Positives = 23/49 (46%) Frame = +1 Query: 91 DRKMFKTHLDMIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPTRR 237 DR+ K H + E + + R+ +S R K ++ + +YR T + Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYRETSK 64 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 20.6 bits (41), Expect = 7.6 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = +1 Query: 73 EYEHDIDRKMFKTHLDMIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPT 231 EY+ DR+ K H + E + + R+ +S R K ++ + +YR T Sbjct: 11 EYKEK-DRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRET 62 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 20.6 bits (41), Expect = 7.6 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = +1 Query: 73 EYEHDIDRKMFKTHLDMIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPT 231 EY+ DR+ K H + E + + R+ +S R K ++ + +YR T Sbjct: 11 EYKEK-DRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRET 62 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 20.6 bits (41), Expect = 7.6 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = +1 Query: 73 EYEHDIDRKMFKTHLDMIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPT 231 EY+ DR+ K H + E + + R+ +S R K ++ + +YR T Sbjct: 11 EYKEK-DRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRET 62 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 20.6 bits (41), Expect = 7.6 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = +1 Query: 73 EYEHDIDRKMFKTHLDMIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPT 231 EY+ DR+ K H + E + + R+ +S R K ++ + +YR T Sbjct: 11 EYKEK-DRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRET 62 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 20.6 bits (41), Expect = 7.6 Identities = 12/49 (24%), Positives = 23/49 (46%) Frame = +1 Query: 91 DRKMFKTHLDMIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPTRR 237 DR+ K H + E + + R+ +S R K ++ + +YR T + Sbjct: 249 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSK 297 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 20.6 bits (41), Expect = 7.6 Identities = 12/49 (24%), Positives = 23/49 (46%) Frame = +1 Query: 91 DRKMFKTHLDMIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPTRR 237 DR+ K H + E + + R+ +S R K ++ + +YR T + Sbjct: 254 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSK 302 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 20.6 bits (41), Expect = 7.6 Identities = 12/49 (24%), Positives = 23/49 (46%) Frame = +1 Query: 91 DRKMFKTHLDMIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPTRR 237 DR+ K H + E + + R+ +S R K ++ + +YR T + Sbjct: 249 DRRYEKLHNEKKKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSK 297 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 20.6 bits (41), Expect = 7.6 Identities = 12/49 (24%), Positives = 23/49 (46%) Frame = +1 Query: 91 DRKMFKTHLDMIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPTRR 237 DR+ K H + E + + R+ +S R K ++ + +YR T + Sbjct: 249 DRRYEKLHNEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYRETSK 297 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 20.6 bits (41), Expect = 7.6 Identities = 13/43 (30%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +1 Query: 76 YEHDIDRKMFKTHLDMIGRNETP-SKKARFWQSFVRSLKGSED 201 Y D + K F + G + P + FW F+ LKG D Sbjct: 548 YSRD-EPKYFIFDAEKTGLGKGPRTTYCAFWNEFLPKLKGIPD 589 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 20.6 bits (41), Expect = 7.6 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 245 KTLRRVGLYLSSALMSSEPFRERT 174 +T+ R G+ LSSA PF R+ Sbjct: 254 QTISRNGVRLSSARAFITPFENRS 277 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,522 Number of Sequences: 438 Number of extensions: 3105 Number of successful extensions: 37 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10997463 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -