BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0573 (455 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z32840-1|CAA83679.1| 584|Caenorhabditis elegans Hypothetical pr... 29 2.1 DQ340623-1|ABC65811.1| 584|Caenorhabditis elegans chondroitin p... 29 2.1 >Z32840-1|CAA83679.1| 584|Caenorhabditis elegans Hypothetical protein C07G2.1a protein. Length = 584 Score = 28.7 bits (61), Expect = 2.1 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -1 Query: 137 LVVEKPFNSDNPLYTLPSNTSVDRNKCILNITTVNNCS 24 +VVE +D P T+P+ T+ + C+ T + CS Sbjct: 501 IVVESTTAADVPTTTVPAETTTEVPACVEGATAIEPCS 538 >DQ340623-1|ABC65811.1| 584|Caenorhabditis elegans chondroitin proteoglycan-1 protein. Length = 584 Score = 28.7 bits (61), Expect = 2.1 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -1 Query: 137 LVVEKPFNSDNPLYTLPSNTSVDRNKCILNITTVNNCS 24 +VVE +D P T+P+ T+ + C+ T + CS Sbjct: 501 IVVESTTAADVPTTTVPAETTTEVPACVEGATAIEPCS 538 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,760,390 Number of Sequences: 27780 Number of extensions: 154295 Number of successful extensions: 270 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 270 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 270 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 809909048 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -