BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0573 (455 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02390.1 68418.m00162 expressed protein ; expression supporte... 28 3.4 >At5g02390.1 68418.m00162 expressed protein ; expression supported by MPSS Length = 835 Score = 27.9 bits (59), Expect = 3.4 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -1 Query: 182 RFGLRDAVGTVTSF*LVVEKPFNSDNPLYTLPSNTSVDRN 63 + G+ AVG++ L+ E+ NSD+ + + +N VD N Sbjct: 197 KVGISPAVGSLNPLYLMSEESSNSDSEEFRVDNNIQVDDN 236 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,015,237 Number of Sequences: 28952 Number of extensions: 136034 Number of successful extensions: 230 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 230 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 752336160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -