BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0569 (442 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 2.1 EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 23 4.8 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 6.4 DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. 22 8.4 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 2.1 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +2 Query: 83 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 184 +GK RS + +++LL P REG H+ Q PG Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 23.0 bits (47), Expect = 4.8 Identities = 16/71 (22%), Positives = 28/71 (39%) Frame = -3 Query: 233 ETLGVCERNIRRSGPVALVVGDDLHLPVLEDTNARVRGTQIDSYCGCFCHFXXXXXXXXX 54 + LG E+ RS PVA V ++ D ++ V G+ + G F H Sbjct: 72 QALGQLEK--ARSKPVAFAVRTNVSYDGSLDDDSPVHGSAVSFEVGDFLHIKEKYDNNWW 129 Query: 53 XLKTTQQTCAI 21 + ++ C + Sbjct: 130 IGRLVKEGCEV 140 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 6.4 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 133 QEYVVPRSIPTAGAFA 86 Q+Y PR++ +AG FA Sbjct: 1244 QDYAPPRALMSAGGFA 1259 >DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. Length = 410 Score = 22.2 bits (45), Expect = 8.4 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = +2 Query: 203 LCCVHRHRASHRRCRQEPGGDEP 271 +CC+ R RR P D+P Sbjct: 322 VCCIESFRRRRRRDAFTPSKDDP 344 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 500,187 Number of Sequences: 2352 Number of extensions: 10362 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36993357 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -