BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0565 (543 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC047469-1|AAH47469.1| 286|Homo sapiens ANGEL2 protein protein. 29 8.0 AL592449-5|CAH71920.1| 544|Homo sapiens novel protein protein. 29 8.0 AL592449-4|CAH71919.1| 375|Homo sapiens novel protein protein. 29 8.0 >BC047469-1|AAH47469.1| 286|Homo sapiens ANGEL2 protein protein. Length = 286 Score = 29.5 bits (63), Expect = 8.0 Identities = 13/52 (25%), Positives = 22/52 (42%) Frame = +2 Query: 11 GCRNSARGHSIAG*TVWSPTGNYSTRCAHDIPQAPGKPEENATAVQPTKQNT 166 G S+RG I +W P S C +++ Q P + ++ Q + T Sbjct: 212 GQEQSSRGQRILSIPIWPPNLGISQNCVYEVQQVPKVEKTDSDLTQTQLKQT 263 >AL592449-5|CAH71920.1| 544|Homo sapiens novel protein protein. Length = 544 Score = 29.5 bits (63), Expect = 8.0 Identities = 13/52 (25%), Positives = 22/52 (42%) Frame = +2 Query: 11 GCRNSARGHSIAG*TVWSPTGNYSTRCAHDIPQAPGKPEENATAVQPTKQNT 166 G S+RG I +W P S C +++ Q P + ++ Q + T Sbjct: 381 GQEQSSRGQRILSIPIWPPNLGISQNCVYEVQQVPKVEKTDSDLTQTQLKQT 432 >AL592449-4|CAH71919.1| 375|Homo sapiens novel protein protein. Length = 375 Score = 29.5 bits (63), Expect = 8.0 Identities = 13/52 (25%), Positives = 22/52 (42%) Frame = +2 Query: 11 GCRNSARGHSIAG*TVWSPTGNYSTRCAHDIPQAPGKPEENATAVQPTKQNT 166 G S+RG I +W P S C +++ Q P + ++ Q + T Sbjct: 212 GQEQSSRGQRILSIPIWPPNLGISQNCVYEVQQVPKVEKTDSDLTQTQLKQT 263 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,077,592 Number of Sequences: 237096 Number of extensions: 1260991 Number of successful extensions: 3235 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3230 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5308067764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -