BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0564 (523 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical pro... 23 1.6 AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 23 1.6 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 23 1.6 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 22 2.9 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 5.0 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 21 5.0 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 6.6 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 21 6.6 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 21 8.7 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.7 >AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical protein protein. Length = 148 Score = 23.0 bits (47), Expect = 1.6 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = -1 Query: 193 NNVLIY*LFNICESAQMWENETKPLDVTSRDSSKSPLKKSQ 71 NN+ + CES + +K +D S SPL+K++ Sbjct: 31 NNLTQSTILTTCESNTDFSFGSKTIDFRKIQCSNSPLRKAR 71 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 23.0 bits (47), Expect = 1.6 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +3 Query: 36 MKYNLSKMVVIY*DFFSGLFEESREVTSSGFVSFSHICALSQILN 170 + YNLS + + D + LF + VS I +LSQ+L+ Sbjct: 185 LTYNLSLGIKLRYDDVNNLFRIEESEEKNIIVSLRQIGSLSQLLS 229 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 23.0 bits (47), Expect = 1.6 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +3 Query: 36 MKYNLSKMVVIY*DFFSGLFEESREVTSSGFVSFSHICALSQILN 170 + YNLS + + D + LF + VS I +LSQ+L+ Sbjct: 185 LTYNLSLGIKLRYDDVNNLFRIEESEEKNIIVSLRQIGSLSQLLS 229 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 22.2 bits (45), Expect = 2.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 339 THVVNINDQNLR 304 T VN+NDQN+R Sbjct: 61 TSSVNVNDQNIR 72 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 5.0 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 126 FVSFSHICALSQILN 170 F+SFS IC L Q L+ Sbjct: 220 FISFSKICYLHQHLS 234 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 21.4 bits (43), Expect = 5.0 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 126 FVSFSHICALSQILN 170 F+SFS IC L Q L+ Sbjct: 238 FISFSKICYLHQHLS 252 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.0 bits (42), Expect = 6.6 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +3 Query: 84 SGLFEESREVTSSGFVSFSHICALSQ 161 SG +E SGF+++ +C L Q Sbjct: 353 SGGGKEGTYTKESGFLAYYEVCELLQ 378 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 21.0 bits (42), Expect = 6.6 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +1 Query: 157 HRY*TINKLKHYYIFIPEETLNRQNKRNH 243 H Y N YY + + LN Q +NH Sbjct: 298 HNYYAQNYAPTYYGQMQPDYLNSQTTQNH 326 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 20.6 bits (41), Expect = 8.7 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 Query: 233 KEITQLHSSRSRQKVHYQ 286 + ITQ HS R + H Q Sbjct: 64 RAITQQHSERDERLAHVQ 81 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.7 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +2 Query: 413 CIVCTKKKDSK 445 C++CT K D+K Sbjct: 1087 CMICTYKADNK 1097 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.7 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +2 Query: 413 CIVCTKKKDSK 445 C++CT K D+K Sbjct: 1087 CMICTYKADNK 1097 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,568 Number of Sequences: 336 Number of extensions: 2325 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -