BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0563 (477 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g32130.1 68416.m04091 hypothetical protein 27 5.0 At1g05820.1 68414.m00609 protease-associated (PA) domain-contain... 27 8.7 >At3g32130.1 68416.m04091 hypothetical protein Length = 214 Score = 27.5 bits (58), Expect = 5.0 Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +1 Query: 250 IKNVFKQTCWW*LW--WKQCTCTIFQHSASRYRQ 345 I ++ +Q W LW WK +++QH +S +R+ Sbjct: 34 IPDIDRQLPIWMLWRIWKSRNLSVYQHKSSTWRE 67 >At1g05820.1 68414.m00609 protease-associated (PA) domain-containing protein contains weak similarity to protease associated (PA) domain proteins, Pfam:PF02225 Length = 441 Score = 26.6 bits (56), Expect = 8.7 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -1 Query: 369 SDSDRCCKLPVSRRTMLENCTS 304 SD D+ KLPV+ T L++C++ Sbjct: 74 SDKDKAVKLPVALTTPLDSCSN 95 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,062,864 Number of Sequences: 28952 Number of extensions: 179762 Number of successful extensions: 504 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 483 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 501 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 821630280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -