BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0562 (646 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual 29 0.43 SPAC11G7.01 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 29 0.57 SPAC1039.02 |||phosphoprotein phosphatase |Schizosaccharomyces p... 28 1.3 SPAC19G12.15c |tpp1||trehalose-6-phosphate phosphatase Tpp1|Schi... 26 5.3 SPCC777.08c |||HbrB family protein|Schizosaccharomyces pombe|chr... 26 5.3 SPBC3E7.01 |fab1|ste12, SPBC6B1.11c|1-phosphatidylinositol-3-pho... 25 9.3 SPBC1289.06c |||sequence orphan|Schizosaccharomyces pombe|chr 2|... 25 9.3 >SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1236 Score = 29.5 bits (63), Expect = 0.43 Identities = 21/49 (42%), Positives = 29/49 (59%) Frame = -3 Query: 368 TYTLFAILSSTPLIDRRSRLLLANSVRIASSSGKPIAFKSSSWVSPSEA 222 TY+ I SS+ L+ S L++++S +ASSS PI SSS VS A Sbjct: 665 TYSSSVIPSSSTLVSSSSSLIVSSS-PVASSSSSPIP-SSSSLVSTYSA 711 >SPAC11G7.01 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 536 Score = 29.1 bits (62), Expect = 0.57 Identities = 19/71 (26%), Positives = 32/71 (45%) Frame = -3 Query: 434 TSELKTSLETTAKXXXXXXXX*TYTLFAILSSTPLIDRRSRLLLANSVRIASSSGKPIAF 255 TS + TSL ++A ++ SS+ + S +L ++S SSS Sbjct: 7 TSSVDTSLSSSASSSIPASSSSAAASTSLSSSSVIPSSSSSMLSSSSATAISSSSSSSPL 66 Query: 254 KSSSWVSPSEA 222 SSS+ SP+ + Sbjct: 67 SSSSFTSPASS 77 >SPAC1039.02 |||phosphoprotein phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 27.9 bits (59), Expect = 1.3 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 298 FASKSRDLRSIKGVELKMANKVYVHDGGKLDE 393 FA + ++L KGV+L M + +HDG L + Sbjct: 79 FALRMKELADFKGVDLLMVDTGDLHDGNGLSD 110 >SPAC19G12.15c |tpp1||trehalose-6-phosphate phosphatase Tpp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 817 Score = 25.8 bits (54), Expect = 5.3 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +3 Query: 12 DAGHKHEDNHLFVYYRHRGNGSRHKSL*CAQKW 110 D K E +F YY R GS + CA W Sbjct: 653 DMSWKKEVRRIFQYYTDRTQGSSIEEKRCAMTW 685 >SPCC777.08c |||HbrB family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 422 Score = 25.8 bits (54), Expect = 5.3 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 457 NTVAAKSINDWVEENTNNRIKDLVNPDSLS 546 +T +A SIN W+ +NT I+ + N SLS Sbjct: 9 STSSASSIN-WIPKNTKTSIESVSNTISLS 37 >SPBC3E7.01 |fab1|ste12, SPBC6B1.11c|1-phosphatidylinositol-3-phosphate 5-kinase Fab1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1932 Score = 25.0 bits (52), Expect = 9.3 Identities = 8/27 (29%), Positives = 19/27 (70%) Frame = -1 Query: 403 LQNSRLVFHHHERILYSPF*AQRL*LI 323 L+ +++ H ++++SPF +QR+ L+ Sbjct: 901 LEKQWTLYYSHSKLMFSPFSSQRIILL 927 >SPBC1289.06c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 481 Score = 25.0 bits (52), Expect = 9.3 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 85 NLSNVLKNGNDNFTARMFTEVV 150 N N+LK ND AR +TE V Sbjct: 56 NSQNLLKQLNDEMKARKYTETV 77 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.315 0.129 0.359 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,504,432 Number of Sequences: 5004 Number of extensions: 49897 Number of successful extensions: 183 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 183 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -