BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0560 (488 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) 42 4e-04 SB_41405| Best HMM Match : RVT_1 (HMM E-Value=0) 35 0.041 SB_45779| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.096 SB_31380| Best HMM Match : zf-CCHC (HMM E-Value=4.6e-05) 33 0.13 SB_10506| Best HMM Match : DNA_pol3_beta (HMM E-Value=4.9) 33 0.13 SB_7613| Best HMM Match : DNA_pol3_beta (HMM E-Value=4.9) 33 0.13 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 33 0.17 SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.22 SB_36217| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.29 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 32 0.29 SB_50497| Best HMM Match : CH (HMM E-Value=0.0084) 31 0.39 SB_46160| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.39 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.39 SB_15028| Best HMM Match : Drf_FH1 (HMM E-Value=0.84) 31 0.39 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.51 SB_54837| Best HMM Match : RnaseH (HMM E-Value=8) 31 0.67 SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_56738| Best HMM Match : Extensin_2 (HMM E-Value=0.076) 30 0.89 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.89 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 30 0.89 SB_795| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.89 SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 30 1.2 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_16233| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_12939| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_46270| Best HMM Match : rve (HMM E-Value=1.2e-09) 29 1.6 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_36059| Best HMM Match : TolA (HMM E-Value=0.1) 29 1.6 SB_30140| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 29 1.6 SB_18645| Best HMM Match : RVT_1 (HMM E-Value=0.0003) 29 1.6 SB_15486| Best HMM Match : rve (HMM E-Value=1.2e-09) 29 1.6 SB_31997| Best HMM Match : zf-C2H2 (HMM E-Value=1.4013e-45) 29 2.1 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 29 2.1 SB_11518| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_4276| Best HMM Match : DUF288 (HMM E-Value=1e-04) 29 2.1 SB_3180| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 29 2.7 SB_9848| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) 29 2.7 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 29 2.7 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_50893| Best HMM Match : SH3_1 (HMM E-Value=2e-33) 28 3.6 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 28 3.6 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 28 3.6 SB_16537| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_25840| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_19592| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_11350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 28 4.7 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_48126| Best HMM Match : RVT_1 (HMM E-Value=5.5e-39) 28 4.7 SB_47174| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_26435| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 28 4.7 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 28 4.7 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_46414| Best HMM Match : Extensin_2 (HMM E-Value=0.31) 28 4.7 SB_43755| Best HMM Match : rve (HMM E-Value=5.6e-11) 28 4.7 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_25393| Best HMM Match : Collagen (HMM E-Value=0.00015) 28 4.7 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 28 4.7 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) 28 4.7 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_49864| Best HMM Match : Ldl_recept_b (HMM E-Value=9) 27 6.3 SB_49539| Best HMM Match : RVT_1 (HMM E-Value=1.8e-39) 27 6.3 SB_44967| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_29142| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_25563| Best HMM Match : HEAT (HMM E-Value=2.5e-20) 27 6.3 SB_14159| Best HMM Match : ETF (HMM E-Value=9.9) 27 6.3 SB_3619| Best HMM Match : RnaseH (HMM E-Value=0.17) 27 6.3 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_663| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_57833| Best HMM Match : RnaseH (HMM E-Value=0.18) 27 6.3 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_45924| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_44757| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) 27 6.3 SB_28642| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) 27 6.3 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 27 6.3 SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) 27 6.3 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 27 6.3 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_13608| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_58829| Best HMM Match : HC2 (HMM E-Value=5.8) 27 8.3 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 27 8.3 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 27 8.3 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 27 8.3 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 27 8.3 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_52986| Best HMM Match : zf-C2H2 (HMM E-Value=0.0042) 27 8.3 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 27 8.3 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 27 8.3 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 27 8.3 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 27 8.3 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_47964| Best HMM Match : Abi_HHR (HMM E-Value=5) 27 8.3 SB_47416| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 27 8.3 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 27 8.3 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 27 8.3 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 27 8.3 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 27 8.3 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 27 8.3 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 27 8.3 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_35833| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_33542| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 27 8.3 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 27 8.3 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 27 8.3 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 27 8.3 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_24600| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_23893| Best HMM Match : rve (HMM E-Value=3.1e-24) 27 8.3 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 27 8.3 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 27 8.3 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_20994| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 27 8.3 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 27 8.3 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 27 8.3 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 27 8.3 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 27 8.3 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 27 8.3 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 27 8.3 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 27 8.3 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 27 8.3 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_6201| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 27 8.3 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 27 8.3 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 27 8.3 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_208| Best HMM Match : zf-C2H2 (HMM E-Value=1.7) 27 8.3 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 27 8.3 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 27 8.3 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 27 8.3 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 27 8.3 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_51416| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 27 8.3 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_48401| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 27 8.3 SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_45308| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_45108| Best HMM Match : RVT_1 (HMM E-Value=4.9e-37) 27 8.3 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 27 8.3 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 27 8.3 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 27 8.3 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_43349| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 >SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) Length = 439 Score = 41.5 bits (93), Expect = 4e-04 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 4/65 (6%) Frame = +2 Query: 128 DEPTGLQPPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVP----SENPLGQEMPSHP 295 + PT + PP D + V P+ D + +PPP+ +AP +VP ++ P P P Sbjct: 73 EAPTTVPPPVVTDAPTTVPPPVVTDAPTTVPPPVVTDAPTTVPPPVVTDAPTTVPPPVQP 132 Query: 296 TQPPT 310 T+PP+ Sbjct: 133 TEPPS 137 Score = 31.5 bits (68), Expect = 0.39 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 149 PPPYLDEQ-SRVDEPLTFDDLSPLPPPIDFNAPGSVPSENPLGQEMPSHPTQPPTKV 316 PPP + E + V P+ D + +PPP+ +AP +VP P+ + P+ T PP V Sbjct: 67 PPPVVTEAPTTVPPPVVTDAPTTVPPPVVTDAPTTVPP--PVVTDAPT--TVPPPVV 119 >SB_41405| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 2639 Score = 34.7 bits (76), Expect = 0.041 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 5/48 (10%) Frame = +2 Query: 50 DYEIEYKKGKLNCNADSLSRNLVHT-----LDEPTGLQPPPYLDEQSR 178 D+EI+Y+ GK N NAD+LSR T +D P GLQ D+Q R Sbjct: 1061 DFEIKYRPGKSNGNADALSRRPYGTCTLGAVDTP-GLQTEDIRDKQRR 1107 >SB_45779| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 946 Score = 33.5 bits (73), Expect = 0.096 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = +2 Query: 41 AAGDYEIEYKKGKLNCNADSLSR 109 A+ D++IEY+ GK N NAD+LSR Sbjct: 401 ASFDFKIEYRSGKHNTNADALSR 423 >SB_31380| Best HMM Match : zf-CCHC (HMM E-Value=4.6e-05) Length = 1082 Score = 33.1 bits (72), Expect = 0.13 Identities = 21/52 (40%), Positives = 28/52 (53%) Frame = +2 Query: 41 AAGDYEIEYKKGKLNCNADSLSRNLVHTLDEPTGLQPPPYLDEQSRVDEPLT 196 +A DYEIEY+ + + N D+LSR L H D G + Y+ D PLT Sbjct: 678 SAYDYEIEYRSSQEHSNCDALSR-LPHE-DSSVGSEGTIYMVSAFDEDFPLT 727 >SB_10506| Best HMM Match : DNA_pol3_beta (HMM E-Value=4.9) Length = 666 Score = 33.1 bits (72), Expect = 0.13 Identities = 21/52 (40%), Positives = 28/52 (53%) Frame = +2 Query: 41 AAGDYEIEYKKGKLNCNADSLSRNLVHTLDEPTGLQPPPYLDEQSRVDEPLT 196 +A DYEIEY+ + + N D+LSR L H D G + Y+ D PLT Sbjct: 287 SAYDYEIEYRSSQEHSNCDALSR-LPHE-DSSVGSEGTIYMVSAFDEDFPLT 336 >SB_7613| Best HMM Match : DNA_pol3_beta (HMM E-Value=4.9) Length = 641 Score = 33.1 bits (72), Expect = 0.13 Identities = 21/52 (40%), Positives = 28/52 (53%) Frame = +2 Query: 41 AAGDYEIEYKKGKLNCNADSLSRNLVHTLDEPTGLQPPPYLDEQSRVDEPLT 196 +A DYEIEY+ + + N D+LSR L H D G + Y+ D PLT Sbjct: 396 SAYDYEIEYRSSQEHSNCDALSR-LPHE-DSSVGSEGTIYMVSAFDEDFPLT 445 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 32.7 bits (71), Expect = 0.17 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = -2 Query: 97 ICVTI*LPLFVFNLVVACSPGDPLV*SAPP 8 + +T L L VF L +CSPGDPLV PP Sbjct: 53 LVITNLLALTVFMLSNSCSPGDPLVLERPP 82 >SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1353 Score = 32.3 bits (70), Expect = 0.22 Identities = 20/61 (32%), Positives = 25/61 (40%) Frame = +2 Query: 125 LDEPTGLQPPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSENPLGQEMPSHPTQP 304 L E L PP +L E + PL + LPPP+ G V PL + H P Sbjct: 869 LREHVELPPPLHLKEHVELPPPLHLKEHVELPPPLHLKEHGHVELPPPL--HLEEHVELP 926 Query: 305 P 307 P Sbjct: 927 P 927 Score = 30.7 bits (66), Expect = 0.67 Identities = 17/57 (29%), Positives = 24/57 (42%) Frame = +2 Query: 125 LDEPTGLQPPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSENPLGQEMPSHP 295 L+E L PP +L E + PL + LPPP+ +P L + M P Sbjct: 919 LEEHVELPPPLHLKEHVELPPPLRLKEHMELPPPLHLKEHVELPPPLHLKEHMELPP 975 Score = 30.3 bits (65), Expect = 0.89 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +2 Query: 125 LDEPTGLQPPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSENPLGQEMPSHPTQP 304 L E L PP +L E + PL + LPPP+ +P PL + H P Sbjct: 699 LKEHVELPPPLHLKEHVELPPPLHLKEHVELPPPLHLKEHVELPP--PLHLKEHEHMELP 756 Query: 305 PT 310 P+ Sbjct: 757 PS 758 Score = 29.5 bits (63), Expect = 1.6 Identities = 19/61 (31%), Positives = 25/61 (40%) Frame = +2 Query: 125 LDEPTGLQPPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSENPLGQEMPSHPTQP 304 L E L PP +L E + PL + LPPP+ +P PL + H P Sbjct: 857 LKEHVELPPPLHLREHVELPPPLHLKEHVELPPPLHLKEHVELPP--PLHLKEHGHVELP 914 Query: 305 P 307 P Sbjct: 915 P 915 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/61 (31%), Positives = 25/61 (40%) Frame = +2 Query: 125 LDEPTGLQPPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSENPLGQEMPSHPTQP 304 L E L PP +L E + PL + LPPP+ +P PL + H P Sbjct: 955 LKEHVELPPPLHLKEHMELPPPLHLKEHVDLPPPLHLKEHVELPP--PL--HLKEHVELP 1010 Query: 305 P 307 P Sbjct: 1011 P 1011 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/61 (31%), Positives = 25/61 (40%) Frame = +2 Query: 125 LDEPTGLQPPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSENPLGQEMPSHPTQP 304 L E L PP +L E + PL + LPPP+ +P PL + H P Sbjct: 979 LKEHVDLPPPLHLKEHVELPPPLHLKEHVELPPPLHLKEHVDLPP--PL--HLKEHVELP 1034 Query: 305 P 307 P Sbjct: 1035 P 1035 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/61 (31%), Positives = 25/61 (40%) Frame = +2 Query: 125 LDEPTGLQPPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSENPLGQEMPSHPTQP 304 L E L PP +L E + PL + LPPP+ +P PL + H P Sbjct: 1015 LKEHVDLPPPLHLKEHVELPPPLHLKEHVDLPPPLHLKEHVELPP--PL--HLKEHVELP 1070 Query: 305 P 307 P Sbjct: 1071 P 1071 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/61 (31%), Positives = 25/61 (40%) Frame = +2 Query: 125 LDEPTGLQPPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSENPLGQEMPSHPTQP 304 L E L PP +L E + PL + LPPP+ +P PL + H P Sbjct: 1039 LKEHVDLPPPLHLKEHVELPPPLHLKEHVELPPPLHLKEHVELPP--PL--HLKEHVELP 1094 Query: 305 P 307 P Sbjct: 1095 P 1095 Score = 27.9 bits (59), Expect = 4.7 Identities = 19/61 (31%), Positives = 25/61 (40%) Frame = +2 Query: 125 LDEPTGLQPPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSENPLGQEMPSHPTQP 304 L E L PP +L E + PL + LPPP+ +P PL + H P Sbjct: 943 LKEHMELPPPLHLKEHVELPPPLHLKEHMELPPPLHLKEHVDLPP--PL--HLKEHVELP 998 Query: 305 P 307 P Sbjct: 999 P 999 Score = 27.5 bits (58), Expect = 6.3 Identities = 18/60 (30%), Positives = 25/60 (41%) Frame = +2 Query: 128 DEPTGLQPPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSENPLGQEMPSHPTQPP 307 +E L PP +L E + PL + LPPP+ +P PL + H PP Sbjct: 688 EEHVELPPPLHLKEHVELPPPLHLKEHVELPPPLHLKEHVELPP--PL--HLKEHVELPP 743 Score = 27.5 bits (58), Expect = 6.3 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +2 Query: 125 LDEPTGLQPPPYLDEQSRVDEPLTFDDLSPLPPPID-FNAP 244 L E L PP +L E + PL + LPPP+ +N P Sbjct: 1063 LKEHVELPPPLHLKEHVELPPPLHLKEHVELPPPLHLWNTP 1103 Score = 27.1 bits (57), Expect = 8.3 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = +2 Query: 143 LQPPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSENPLGQEMPSHPTQPP 307 L PP +L+E + PL + LPPP+ +P PL + H PP Sbjct: 913 LPPPLHLEEHVELPPPLHLKEHVELPPPLRLKEHMELPP--PL--HLKEHVELPP 963 Score = 27.1 bits (57), Expect = 8.3 Identities = 19/61 (31%), Positives = 25/61 (40%) Frame = +2 Query: 125 LDEPTGLQPPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSENPLGQEMPSHPTQP 304 L E L PP +L E + PL + LPPP+ +P PL + H P Sbjct: 1003 LKEHVELPPPLHLKEHVDLPPPLHLKEHVELPPPLHLKEHVDLPP--PL--HLKEHVELP 1058 Query: 305 P 307 P Sbjct: 1059 P 1059 >SB_36217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1356 Score = 31.9 bits (69), Expect = 0.29 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +2 Query: 29 WIPRAAG-DYEIEYKKGKLNCNADSLSRNLVHTLDE 133 W A D+ I+YK G+ N NAD+LSR +H +E Sbjct: 762 WAAELANFDFSIKYKPGRHNVNADALSR--IHRYEE 795 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 31.9 bits (69), Expect = 0.29 Identities = 21/60 (35%), Positives = 25/60 (41%), Gaps = 2/60 (3%) Frame = +2 Query: 134 PTGLQPPPYLDEQ-SRVDEPLTFDDLS-PLPPPIDFNAPGSVPSENPLGQEMPSHPTQPP 307 P GL P L+ V + +T P PPP D +AP P P G P P PP Sbjct: 264 PQGLDLPDVLEHDIPEVPDIVTGGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPP 323 >SB_50497| Best HMM Match : CH (HMM E-Value=0.0084) Length = 2086 Score = 31.5 bits (68), Expect = 0.39 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 4/76 (5%) Frame = +2 Query: 89 NADSLSRNLVHTLDEPTGLQPPPYLDEQSRVDEPLTFDDLSP----LPPPIDFNAPGSVP 256 N ++L VH + T + P +SRVD+ T + L P + PP + AP + P Sbjct: 1457 NKETLPGQSVHI--DSTQEEVPVEAQPESRVDQNQTPESLLPAEYLVAPPEEQPAPAAEP 1514 Query: 257 SENPLGQEMPSHPTQP 304 +P G PT P Sbjct: 1515 EPSPGGSPSDLSPTDP 1530 >SB_46160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1488 Score = 31.5 bits (68), Expect = 0.39 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +2 Query: 209 SPLPPPIDFNAPGSVPSENPLGQEMPSHPTQPP 307 SP PP +PG+ PSE +EMPS PT P Sbjct: 958 SPRTPPETRCSPGA-PSETRYNREMPSEPTYSP 989 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 31.5 bits (68), Expect = 0.39 Identities = 17/48 (35%), Positives = 19/48 (39%) Frame = -3 Query: 267 GFSEGTEPGALKSMGGGNGDKSSNVRGSSTRDCSSRYGGGCKPVGSSR 124 GF G P GGG G S GS + C GGG GS + Sbjct: 469 GFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGG--GGGSYNAGSDK 514 >SB_15028| Best HMM Match : Drf_FH1 (HMM E-Value=0.84) Length = 944 Score = 31.5 bits (68), Expect = 0.39 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 4/76 (5%) Frame = +2 Query: 89 NADSLSRNLVHTLDEPTGLQPPPYLDEQSRVDEPLTFDDLSP----LPPPIDFNAPGSVP 256 N ++L VH + T + P +SRVD+ T + L P + PP + AP + P Sbjct: 352 NKETLPGQSVHI--DSTQEEVPVEAQPESRVDQNQTPESLLPAEYLVAPPEEQPAPAAEP 409 Query: 257 SENPLGQEMPSHPTQP 304 +P G PT P Sbjct: 410 EPSPGGSPSDLSPTDP 425 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.1 bits (67), Expect = 0.51 Identities = 15/25 (60%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = -2 Query: 76 PLFVFNLVVA--CSPGDPLV*SAPP 8 P+FV N V+ CSPGDPLV PP Sbjct: 3 PIFVSNDAVSNSCSPGDPLVLERPP 27 >SB_54837| Best HMM Match : RnaseH (HMM E-Value=8) Length = 226 Score = 30.7 bits (66), Expect = 0.67 Identities = 13/28 (46%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +2 Query: 29 WIPRAAG-DYEIEYKKGKLNCNADSLSR 109 W+ A ++ I+Y+ GK+N +ADSLSR Sbjct: 105 WVGELADYNFNIKYRPGKMNVDADSLSR 132 >SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2851 Score = 30.7 bits (66), Expect = 0.67 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 6/55 (10%) Frame = +2 Query: 167 EQSRVDEPLTFDDLSPLPPPIDFNAPGSVPS-ENPLGQ-EMP----SHPTQPPTK 313 E++ +P T P PPP AP + P+ + PL Q + P S+PTQPP++ Sbjct: 92 EKTETSQPAT--TTVPAPPPSSTTAPVNAPAQQQPLLQPQRPTPPSSYPTQPPSR 144 >SB_56738| Best HMM Match : Extensin_2 (HMM E-Value=0.076) Length = 869 Score = 30.3 bits (65), Expect = 0.89 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 149 PPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVP 256 PPP ++ +D + D SP+PPP+DF P P Sbjct: 323 PPPPMEA---IDFTSSADVPSPIPPPLDFATPPMAP 355 Score = 29.9 bits (64), Expect = 1.2 Identities = 23/72 (31%), Positives = 31/72 (43%), Gaps = 9/72 (12%) Frame = +2 Query: 125 LDEPTGLQPPPYLDEQSRVDEPLTFDDLSP-----LPPP----IDFNAPGSVPSENPLGQ 277 L +P L+PP E E + +L P LPPP IDF + VPS P Sbjct: 288 LSKPEPLEPPGCFAESQASHEDMG-SELVPGGMVVLPPPPMEAIDFTSSADVPSPIPPPL 346 Query: 278 EMPSHPTQPPTK 313 + + P PP + Sbjct: 347 DFATPPMAPPVE 358 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.3 bits (65), Expect = 0.89 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -2 Query: 79 LPLFVFNLVVACSPGDPLV*SAPP 8 +P F+ +CSPGDPLV PP Sbjct: 5 IPYFIMLASNSCSPGDPLVLERPP 28 >SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) Length = 270 Score = 30.3 bits (65), Expect = 0.89 Identities = 14/24 (58%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = -2 Query: 73 LFVFNLVVA--CSPGDPLV*SAPP 8 LF NL+ + CSPGDPLV PP Sbjct: 139 LFSINLITSNSCSPGDPLVLERPP 162 >SB_795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 30.3 bits (65), Expect = 0.89 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -2 Query: 73 LFVFNLVVACSPGDPLV*SAPP 8 L++F +CSPGDPLV PP Sbjct: 3 LYIFYASNSCSPGDPLVLERPP 24 >SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 29.9 bits (64), Expect = 1.2 Identities = 20/54 (37%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = -3 Query: 285 GISCPRGFSEGTEPGALKSMGGGNGDKSSNVRGS-STRDCSSRYGGGCKPVGSS 127 G S G GT G+ + GGG G S++ S ST GGG GSS Sbjct: 189 GASAGGGGGVGTTGGSTGAAGGGGGGTSTSTGSSGSTGTSMVTSGGGISTSGSS 242 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 29.9 bits (64), Expect = 1.2 Identities = 20/54 (37%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = -3 Query: 285 GISCPRGFSEGTEPGALKSMGGGNGDKSSNVRGS-STRDCSSRYGGGCKPVGSS 127 G S G GT G+ + GGG G S++ S ST GGG GSS Sbjct: 235 GASAGGGGGVGTTGGSTGAAGGGGGGTSTSTGSSGSTGTSMVTSGGGISTSGSS 288 >SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 29.9 bits (64), Expect = 1.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 73 LFVFNLVVACSPGDPLV*SAPP 8 LF+ +CSPGDPLV PP Sbjct: 57 LFIITTSNSCSPGDPLVLERPP 78 >SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -2 Query: 73 LFVFNLVVACSPGDPLV*SAPP 8 L F L +CSPGDPLV PP Sbjct: 56 LAAFELSNSCSPGDPLVLERPP 77 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 29.9 bits (64), Expect = 1.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 73 LFVFNLVVACSPGDPLV*SAPP 8 LF+ +CSPGDPLV PP Sbjct: 83 LFIIQTSNSCSPGDPLVLERPP 104 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -2 Query: 70 FVFNLVVACSPGDPLV*SAPP 8 F F L +CSPGDPLV PP Sbjct: 9 FYFILSNSCSPGDPLVLERPP 29 >SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -2 Query: 100 GICV-TI*LPLFVFNLVVACSPGDPLV*SAPP 8 G+CV + + V + +CSPGDPLV PP Sbjct: 31 GVCVRALRNDVLVIGISNSCSPGDPLVLERPP 62 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 29.5 bits (63), Expect = 1.6 Identities = 19/59 (32%), Positives = 25/59 (42%), Gaps = 4/59 (6%) Frame = +2 Query: 149 PPPYLDEQSRVDEPLTFDDLSPLP---PPIDFNAPGSVPSENPLGQEMPSHPTQ-PPTK 313 P P ++ P T P P PPI + P + PS NP P P+ PPT+ Sbjct: 188 PTPSSYPPTQPSYPPTAPSYPPTPSSYPPIAASYPPTAPSYNPTAPSYPPTPSSYPPTQ 246 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 29.5 bits (63), Expect = 1.6 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 70 FVFNLVVACSPGDPLV*SAPP 8 FV + +CSPGDPLV PP Sbjct: 36 FVLRVSNSCSPGDPLVLERPP 56 >SB_16233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 502 Score = 29.5 bits (63), Expect = 1.6 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = +2 Query: 41 AAGDYEIEYKKGKLNCNADSLSR 109 A+ +++I+Y+ GK N NAD+LSR Sbjct: 148 ASFNFKIKYRAGKHNTNADALSR 170 >SB_12939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 575 Score = 29.5 bits (63), Expect = 1.6 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +2 Query: 146 QPPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSEN-PLGQEMPS 289 QPP + + P+ + + PLP P D P S P G+ +PS Sbjct: 105 QPPRQISNDRSLTLPVRYQMVGPLPSPSDIKWPVSYPPRQISNGRTLPS 153 >SB_46270| Best HMM Match : rve (HMM E-Value=1.2e-09) Length = 657 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 6/40 (15%) Frame = +2 Query: 143 LQPPPYLDEQSRVDE------PLTFDDLSPLPPPIDFNAP 244 L PP Y Q+ + + PL++DDLS P DFN P Sbjct: 593 LPPPDYQFGQAEIHKVLLGWIPLSYDDLSQFPGSEDFNPP 632 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.5 bits (63), Expect = 1.6 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -2 Query: 79 LPLFVFNLVV-ACSPGDPLV*SAPP 8 LP ++ +V +CSPGDPLV PP Sbjct: 4 LPFYLIPMVSNSCSPGDPLVLERPP 28 >SB_36059| Best HMM Match : TolA (HMM E-Value=0.1) Length = 1936 Score = 29.5 bits (63), Expect = 1.6 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +2 Query: 212 PLPPPIDFNA-PGSVPSENPLGQEMPSH 292 P+PPP F+ P V PLG + PSH Sbjct: 1500 PIPPPASFSVVPYPVRRRAPLGSDPPSH 1527 >SB_30140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.5 bits (63), Expect = 1.6 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -2 Query: 73 LFVFNLVVACSPGDPLV*SAPP 8 L+ + L +CSPGDPLV PP Sbjct: 5 LWCYELSNSCSPGDPLVLERPP 26 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 29.5 bits (63), Expect = 1.6 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 2/60 (3%) Frame = +2 Query: 134 PTGLQPPPYLDEQSRVDEPLTFDDLS-PLPPPIDF-NAPGSVPSENPLGQEMPSHPTQPP 307 P G PPPY+ ++ P + P PPP + PG P P G +P PP Sbjct: 201 PGGYAPPPYVPQEGGGIPPQNHPLTNYPAPPPQGYAPPPGGYPGAPPAG----GYPGAPP 256 >SB_18645| Best HMM Match : RVT_1 (HMM E-Value=0.0003) Length = 1205 Score = 29.5 bits (63), Expect = 1.6 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 29 WIPRAAG-DYEIEYKKGKLNCNADSLSRNLVHTLDEPTGLQPPPYL 163 W+ A D I Y++GKLN AD LSR + EPT YL Sbjct: 851 WLSALAPFDITITYRQGKLNGGADGLSR-IPREGSEPTPEDKEDYL 895 >SB_15486| Best HMM Match : rve (HMM E-Value=1.2e-09) Length = 662 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 6/40 (15%) Frame = +2 Query: 143 LQPPPYLDEQSRVDE------PLTFDDLSPLPPPIDFNAP 244 L PP Y Q+ + + PL++DDLS P DFN P Sbjct: 598 LPPPDYQFGQAEIHKVLLGWIPLSYDDLSQFPGSEDFNPP 637 >SB_31997| Best HMM Match : zf-C2H2 (HMM E-Value=1.4013e-45) Length = 1091 Score = 29.1 bits (62), Expect = 2.1 Identities = 13/55 (23%), Positives = 25/55 (45%) Frame = +2 Query: 47 GDYEIEYKKGKLNCNADSLSRNLVHTLDEPTGLQPPPYLDEQSRVDEPLTFDDLS 211 G+Y+ E+ + ++ ++ VH LDEP P + L+ DD++ Sbjct: 303 GEYQTEFTSPSSQVDENAQTKGTVHLLDEPEEGNETPTAQVAGKPSSALSVDDVA 357 >SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.1 bits (62), Expect = 2.1 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 61 NLVVACSPGDPLV*SAPP 8 NL +CSPGDPLV PP Sbjct: 3 NLSNSCSPGDPLVLERPP 20 >SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.1 bits (62), Expect = 2.1 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 61 NLVVACSPGDPLV*SAPP 8 NL +CSPGDPLV PP Sbjct: 23 NLSNSCSPGDPLVLERPP 40 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 29.1 bits (62), Expect = 2.1 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 3/37 (8%) Frame = +2 Query: 47 GDYEIEY---KKGKLNCNADSLSRNLVHTLDEPTGLQ 148 GDYEIE +K +L SLSRNL+ D LQ Sbjct: 2442 GDYEIEAIKEEKDRLTGEISSLSRNLIQQRDAAEALQ 2478 >SB_11518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1144 Score = 29.1 bits (62), Expect = 2.1 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 5/60 (8%) Frame = -3 Query: 294 GWLGI---SCPRGFSEGTEPGALKSMGGGNGDKSSNVR--GSSTRDCSSRYGGGCKPVGS 130 GW G+ + P F+E +P A+ + G + SNV +S ++ + R+ C P+G+ Sbjct: 164 GWYGVLISNLPEPFTESFKPHAISANIPGEDSRPSNVGVISTSCQEHARRFSVLCGPLGA 223 >SB_4276| Best HMM Match : DUF288 (HMM E-Value=1e-04) Length = 687 Score = 29.1 bits (62), Expect = 2.1 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 3/37 (8%) Frame = +2 Query: 47 GDYEIEY---KKGKLNCNADSLSRNLVHTLDEPTGLQ 148 GDYEIE +K +L SLSRNL+ D LQ Sbjct: 618 GDYEIEAIKEEKDRLTGEISSLSRNLIQQRDAAEALQ 654 >SB_3180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 29.1 bits (62), Expect = 2.1 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 2/59 (3%) Frame = +2 Query: 134 PTGLQPP-PYLDEQSRVDEPLTFDDLSPLPP-PIDFNAPGSVPSENPLGQEMPSHPTQP 304 PT QP P + + P + P PP P P V + PL QE+P PT+P Sbjct: 255 PTATQPQNPAIPQPQNPAIPQLPNPAIPQPPNPPSGGQPQQVVTSQPLNQEVP-QPTKP 312 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 28.7 bits (61), Expect = 2.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 73 LFVFNLVVACSPGDPLV*SAPP 8 + V N +CSPGDPLV PP Sbjct: 9 IHVLNSSNSCSPGDPLVLERPP 30 >SB_9848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 423 Score = 28.7 bits (61), Expect = 2.7 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = +2 Query: 122 TLDEPTGLQPPPYLDEQSRVDEPLTFDDLSPLP--PPI 229 TLDE L PP + E VDEP +L + PPI Sbjct: 358 TLDEAPPLDEPPPMSEYLPVDEPAPISELPSIREIPPI 395 >SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) Length = 1850 Score = 28.7 bits (61), Expect = 2.7 Identities = 19/77 (24%), Positives = 28/77 (36%), Gaps = 2/77 (2%) Frame = +2 Query: 83 NCNADSLSRNLVHTLDEPTGL--QPPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVP 256 N SL+ ++H + P Q P + RV P + P P P + P P Sbjct: 1409 NITQPSLATCIIHQVSRPIPAKRQMPESNPTERRVSPPFPAEHRIPPPDPAERRVPPPFP 1468 Query: 257 SENPLGQEMPSHPTQPP 307 +E P+ PP Sbjct: 1469 AERRTPAPDPAERRVPP 1485 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.7 bits (61), Expect = 2.7 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 64 FNLVVACSPGDPLV*SAPP 8 F++ +CSPGDPLV PP Sbjct: 30 FSISNSCSPGDPLVLERPP 48 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 2.7 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 70 FVFNLVVACSPGDPLV*SAPP 8 FV + +CSPGDPLV PP Sbjct: 13 FVSKVSNSCSPGDPLVLERPP 33 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 28.7 bits (61), Expect = 2.7 Identities = 20/54 (37%), Positives = 25/54 (46%) Frame = +2 Query: 134 PTGLQPPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSENPLGQEMPSHP 295 P+ PPP +D+ L + LSP PPP S+PS P MPS P Sbjct: 309 PSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPSEDFYSMPSSLP----MPSPP 358 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 2.7 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 67 VFNLVVACSPGDPLV*SAPP 8 VF + +CSPGDPLV PP Sbjct: 14 VFLISNSCSPGDPLVLERPP 33 >SB_50893| Best HMM Match : SH3_1 (HMM E-Value=2e-33) Length = 665 Score = 28.3 bits (60), Expect = 3.6 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 9/67 (13%) Frame = +2 Query: 125 LDEPTGLQPPPYLD----EQSRVDEPLTFDDLS-----PLPPPIDFNAPGSVPSENPLGQ 277 LD TGL P +++ E + ++P ++ S P P ++ AP PSE Sbjct: 259 LDGKTGLFPDNFVEILPEETDKPEKPEKMEEKSEKAVPPAPKQVEQRAPPPQPSEEKQDI 318 Query: 278 EMPSHPT 298 +PS PT Sbjct: 319 PLPSKPT 325 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 73 LFVFNLVVACSPGDPLV*SAPP 8 LFV N +CSPGDPLV PP Sbjct: 8 LFVSN---SCSPGDPLVLERPP 26 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 28.3 bits (60), Expect = 3.6 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 73 LFVFNLVVACSPGDPLV*SAPP 8 +F + +CSPGDPLV PP Sbjct: 1 MFALSASNSCSPGDPLVLERPP 22 >SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 3.6 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 67 VFNLVVACSPGDPLV*SAPP 8 + ++++C PGDPLV PP Sbjct: 61 LITIIISCIPGDPLVLERPP 80 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 28.3 bits (60), Expect = 3.6 Identities = 16/53 (30%), Positives = 20/53 (37%) Frame = -3 Query: 306 GG*VGWLGISCPRGFSEGTEPGALKSMGGGNGDKSSNVRGSSTRDCSSRYGGG 148 G VG G C G G G + GGG G + G++ GGG Sbjct: 50 GNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGG 102 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 28.3 bits (60), Expect = 3.6 Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = -3 Query: 294 GWLGISCPR---GFSEGTEPGALKSMGGGNGDKSSN 196 GW+G G++ G PGA+ GGG G N Sbjct: 331 GWVGGRAGNMNSGYNGGPSPGAVGGFGGGGGGSEDN 366 >SB_16537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 28.3 bits (60), Expect = 3.6 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 6/50 (12%) Frame = +2 Query: 125 LDEPTGLQPPPYLDEQSRVDE------PLTFDDLSPLPPPIDFNAPGSVP 256 LD G+ PP Y + V P ++D+LS P DFN P + P Sbjct: 174 LDTNDGVTPPNYQFGPTEVHRTLLNWVPFSYDELSLFPGSEDFNPPATRP 223 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 3.6 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -2 Query: 61 NLVVACSPGDPLV*SAPP 8 N+ +CSPGDPLV PP Sbjct: 3 NISNSCSPGDPLVLERPP 20 >SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/23 (60%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Frame = -2 Query: 70 FVF--NLVVACSPGDPLV*SAPP 8 FVF N +CSPGDPLV PP Sbjct: 20 FVFDPNTSNSCSPGDPLVLERPP 42 >SB_25840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 768 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 161 LDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSEN 265 ++E+ VDEP+ + P PPP +APG+ S N Sbjct: 325 MNEEKPVDEPVA--EPKPEPPPQPDSAPGASSSPN 357 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 28.3 bits (60), Expect = 3.6 Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 3/34 (8%) Frame = -2 Query: 100 GICVTI*LPLFV-FNLVVA--CSPGDPLV*SAPP 8 GIC + + LF+ + L ++ CSPGDPLV PP Sbjct: 155 GICFVL-MGLFMQYELFLSNSCSPGDPLVLERPP 187 >SB_19592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 3.6 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -2 Query: 73 LFVFNLVVACSPGDPLV*SAPP 8 +++ + +CSPGDPLV PP Sbjct: 8 IYILDTSNSCSPGDPLVLERPP 29 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 28.3 bits (60), Expect = 3.6 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -2 Query: 76 PLFVFNLVVACSPGDPLV*SAPP 8 PLF+ + +CSPGDPLV PP Sbjct: 18 PLFLISN--SCSPGDPLVLERPP 38 >SB_11350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 28.3 bits (60), Expect = 3.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -2 Query: 76 PLFVFNLVVACSPGDPLV*SAPP 8 P+F N +CSPGDPLV PP Sbjct: 21 PVFTSN---SCSPGDPLVLERPP 40 >SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 28.3 bits (60), Expect = 3.6 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 79 LPLFVFNLVVACSPGDPLV*SAPP 8 L L + L +CSPGDPLV PP Sbjct: 22 LKLVLQGLSNSCSPGDPLVLERPP 45 >SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 3.6 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 64 FNLVVACSPGDPLV*SAPP 8 F + +CSPGDPLV PP Sbjct: 2 FGISNSCSPGDPLVLERPP 20 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 3.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 70 FVFNLVVACSPGDPLV*SAPP 8 F+ ++ +CSPGDPLV PP Sbjct: 6 FINSVSNSCSPGDPLVLERPP 26 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/24 (50%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = -2 Query: 76 PLFVFNLVV-ACSPGDPLV*SAPP 8 P ++ ++V +CSPGDPLV PP Sbjct: 341 PQYLHSIVSNSCSPGDPLVLERPP 364 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 73 LFVFNLVVACSPGDPLV*SAPP 8 L F + +CSPGDPLV PP Sbjct: 13 LISFLISNSCSPGDPLVLERPP 34 >SB_48126| Best HMM Match : RVT_1 (HMM E-Value=5.5e-39) Length = 1510 Score = 27.9 bits (59), Expect = 4.7 Identities = 19/57 (33%), Positives = 29/57 (50%) Frame = +2 Query: 41 AAGDYEIEYKKGKLNCNADSLSRNLVHTLDEPTGLQPPPYLDEQSRVDEPLTFDDLS 211 A+ Y++ Y+KG + NAD LSR V D+P L+ D P+T D++ Sbjct: 778 ASHQYDVVYRKGVDHSNADGLSRLPV---DKPRVLEETEIYHFSYVDDLPVTARDIA 831 >SB_47174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1198 Score = 27.9 bits (59), Expect = 4.7 Identities = 27/81 (33%), Positives = 38/81 (46%), Gaps = 3/81 (3%) Frame = +2 Query: 50 DYEIEYKKGKLNCNADSLSRNLVHTLDEPTGLQ-PPPYLD--EQSRVDEPLTFDDLSPLP 220 DYEI Y+ GK N A +LSR L Q P +LD R D+ DL+ + Sbjct: 621 DYEIVYRPGKSNVVAGALSRRPNENLQLYAFNQGPRQFLDIFHHQRKDK-----DLAAI- 674 Query: 221 PPIDFNAPGSVPSENPLGQEM 283 IDF +P +N L +++ Sbjct: 675 --IDFLESHVLPKDNKLARQL 693 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +2 Query: 215 LPPPIDFNAPGSVPSENPLGQEMPSHPTQPP 307 +PPP+ S P P+G M + P PP Sbjct: 1209 IPPPMTNTMTHSAPRPPPMGHHMMNMPPPPP 1239 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 Query: 73 LFVFNLVVACSPGDPLV*SAPP 8 + + +L +CSPGDPLV PP Sbjct: 30 VIIASLSNSCSPGDPLVLERPP 51 >SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 70 FVFNLVVACSPGDPLV*SAPP 8 F L +CSPGDPLV PP Sbjct: 4 FTDTLSNSCSPGDPLVLERPP 24 >SB_26435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 188 PLTFDDLSPLPPPIDFNAP 244 PL++DDLS P DFN P Sbjct: 83 PLSYDDLSQFPGSEDFNPP 101 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -2 Query: 73 LFVFNLVVACSPGDPLV*SAPP 8 LF+ + +CSPGDPLV PP Sbjct: 33 LFLDLISNSCSPGDPLVLERPP 54 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 64 FNLVVACSPGDPLV*SAPP 8 F + +CSPGDPLV PP Sbjct: 32 FKVSNSCSPGDPLVLERPP 50 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 2/20 (10%) Frame = -2 Query: 61 NLVVA--CSPGDPLV*SAPP 8 N+V++ CSPGDPLV PP Sbjct: 12 NIVISNSCSPGDPLVLERPP 31 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 70 FVFNLVVACSPGDPLV*SAPP 8 +V ++ +CSPGDPLV PP Sbjct: 48 YVNDISNSCSPGDPLVLERPP 68 >SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.9 bits (59), Expect = 4.7 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 94 CVTI*LPLFVFNLVVACSPGDPLV*SAPP 8 C+ L + N +CSPGDPLV PP Sbjct: 17 CLVFILLVHDHNQSNSCSPGDPLVLERPP 45 >SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 76 PLFVFNLVVACSPGDPLV*SAPP 8 P + L +CSPGDPLV PP Sbjct: 5 PDVISELSNSCSPGDPLVLERPP 27 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -2 Query: 61 NLVVACSPGDPLV*SAPP 8 N+ +CSPGDPLV PP Sbjct: 213 NVSNSCSPGDPLVLERPP 230 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 64 FNLVVACSPGDPLV*SAPP 8 F + +CSPGDPLV PP Sbjct: 30 FRVSNSCSPGDPLVLERPP 48 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 Query: 70 FVFNLVVACSPGDPLV*SAPP 8 F + + +CSPGDPLV PP Sbjct: 17 FQWQISNSCSPGDPLVLERPP 37 >SB_46414| Best HMM Match : Extensin_2 (HMM E-Value=0.31) Length = 469 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 221 PPIDFNAPGSVPSENPLGQEMPSHPTQP 304 P ++ ++PG P ENP + PS QP Sbjct: 5 PHLEIHSPGITPLENPQSRYYPSGNPQP 32 >SB_43755| Best HMM Match : rve (HMM E-Value=5.6e-11) Length = 461 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/21 (52%), Positives = 17/21 (80%) Frame = +2 Query: 50 DYEIEYKKGKLNCNADSLSRN 112 D+ I ++KG L+ NAD+LSR+ Sbjct: 137 DFSIVHRKGSLHGNADALSRH 157 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -2 Query: 61 NLVVACSPGDPLV*SAPP 8 N+ +CSPGDPLV PP Sbjct: 40 NVSNSCSPGDPLVLERPP 57 >SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.9 bits (59), Expect = 4.7 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = -2 Query: 97 ICVTI*LPLFVFNLVVACSPGDPLV*SAPP 8 +CV I L L F +CSPGDPLV PP Sbjct: 1 MCVVITLSLG-FVPSNSCSPGDPLVLERPP 29 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 64 FNLVVACSPGDPLV*SAPP 8 F + +CSPGDPLV PP Sbjct: 28 FGVSNSCSPGDPLVLERPP 46 >SB_25393| Best HMM Match : Collagen (HMM E-Value=0.00015) Length = 391 Score = 27.9 bits (59), Expect = 4.7 Identities = 21/64 (32%), Positives = 27/64 (42%), Gaps = 6/64 (9%) Frame = +2 Query: 134 PTGLQPPPYLDEQSRVD-EPLTFDDLSP----LPPPIDFNAPGSVPSENPLG-QEMPSHP 295 P +QPPP + VD +P D P PPP+D P + P+ Q P Sbjct: 287 PVDIQPPPVDIQPPPVDIQPPPVDIQQPPVDIQPPPVDIQPPPVDIQQPPVDIQPPPVDI 346 Query: 296 TQPP 307 QPP Sbjct: 347 QQPP 350 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 27.9 bits (59), Expect = 4.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 225 GGGNGDKSSNVRGSSTRDCSSRYGG 151 GGG G S G++ C+++YGG Sbjct: 307 GGGGGHFSGGAGGAAATGCTNQYGG 331 Score = 27.1 bits (57), Expect = 8.3 Identities = 19/48 (39%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = -3 Query: 285 GISCPRGFSEGTEPGALKSMGGGNGDKSSNVRGSSTRDCSSR--YGGG 148 G SC RG G G GGG G + N +D +SR YGGG Sbjct: 358 GNSCQRGGQSGGAAGTASMGGGGGGLQFGN------QDYTSRLSYGGG 399 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.9 bits (59), Expect = 4.7 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -2 Query: 76 PLFVFNLVVACSPGDPLV*SAPP 8 P+ V N +CSPGDPLV PP Sbjct: 24 PMLVSN---SCSPGDPLVLERPP 43 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 64 FNLVVACSPGDPLV*SAPP 8 F L +CSPGDPLV PP Sbjct: 103 FILSNSCSPGDPLVLERPP 121 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 64 FNLVVACSPGDPLV*SAPP 8 F L +CSPGDPLV PP Sbjct: 6 FLLSNSCSPGDPLVLERPP 24 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 27.9 bits (59), Expect = 4.7 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 Query: 203 DLSPLPPPIDFNAPGSVPSENPLGQEMPSHPTQPP 307 ++SP PPP P S P P P P QPP Sbjct: 362 NMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPP 396 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 2/20 (10%) Frame = -2 Query: 61 NLVVA--CSPGDPLV*SAPP 8 N+V++ CSPGDPLV PP Sbjct: 23 NIVISNSCSPGDPLVLERPP 42 >SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) Length = 991 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 70 FVFNLVVACSPGDPLV*SAPP 8 F N +CSPGDPLV PP Sbjct: 532 FFGNASNSCSPGDPLVLERPP 552 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -2 Query: 67 VFNLVVACSPGDPLV*SAPP 8 V+ + +CSPGDPLV PP Sbjct: 27 VYPVSNSCSPGDPLVLERPP 46 >SB_49864| Best HMM Match : Ldl_recept_b (HMM E-Value=9) Length = 306 Score = 27.5 bits (58), Expect = 6.3 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 29 WIPRAAG-DYEIEYKKGKLNCNADSLSRNLVHTLDEPTGLQPPPYL 163 W+ A D I Y++GK N +AD LSR + EPT YL Sbjct: 4 WLSALAPFDITITYRQGKSNGDADGLSR-IPREGSEPTPEDKEDYL 48 >SB_49539| Best HMM Match : RVT_1 (HMM E-Value=1.8e-39) Length = 1311 Score = 27.5 bits (58), Expect = 6.3 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +2 Query: 41 AAGDYEIEYKKGKLNCNADSLSRNLVH--TLDEPTGLQPPPYLDEQSRVDEPLTFDDLS 211 A+ Y++ Y+KG + NAD LSR V + E T + Y+D D P+T D++ Sbjct: 677 ASHQYDVVYRKGVDHSNADGLSRLPVDKPRVSEETEIYHFSYVD-----DLPVTAKDIA 730 >SB_44967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1284 Score = 27.5 bits (58), Expect = 6.3 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +2 Query: 41 AAGDYEIEYKKGKLNCNADSLSRNLVH--TLDEPTGLQPPPYLDEQSRVDEPLTFDDLS 211 A+ Y++ Y+KG + NAD LSR V + E T + Y+D D P+T D++ Sbjct: 828 ASHQYDVVYRKGVDHSNADGLSRLPVDKPRVSEETEIYNFSYVD-----DLPVTAKDIA 881 >SB_29142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.5 bits (58), Expect = 6.3 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = +2 Query: 167 EQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSENPLGQEMPSHPTQPP 307 E++ +E + D P+PP I P + + + S PTQ P Sbjct: 15 EKAAKEEVVIDDKPRPIPPEITATLPPVAEGDESVDEPSASEPTQAP 61 >SB_25563| Best HMM Match : HEAT (HMM E-Value=2.5e-20) Length = 1803 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 74 PFCIQSRSRLQPGGSTSLE 18 PFC Q L+PGGS S+E Sbjct: 1457 PFCSQHCQTLEPGGSCSVE 1475 >SB_14159| Best HMM Match : ETF (HMM E-Value=9.9) Length = 288 Score = 27.5 bits (58), Expect = 6.3 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +2 Query: 41 AAGDYEIEYKKGKLNCNADSLSRNLVH--TLDEPTGLQPPPYLDEQSRVDEPLTFDDLS 211 A+ Y++ Y+KG + NAD LSR V + E T + Y+D D P+T D++ Sbjct: 163 ASHQYDVVYRKGVDHSNADGLSRLPVDKPRVSEETEIYHFSYVD-----DLPVTAKDIA 216 >SB_3619| Best HMM Match : RnaseH (HMM E-Value=0.17) Length = 227 Score = 27.5 bits (58), Expect = 6.3 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 29 WIPRAAG-DYEIEYKKGKLNCNADSLSRNLVHTLDEPTGLQPPPYL 163 W+ A D I Y++GK N +AD LSR + EPT YL Sbjct: 139 WLSALAPFDITITYRQGKSNGDADGLSR-IPREGSEPTPEDKEDYL 183 >SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -2 Query: 67 VFNLVVACSPGDPLV*SAPP 8 + +L +CSPGDPLV PP Sbjct: 1 MLSLSNSCSPGDPLVLERPP 20 >SB_663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2028 Score = 27.5 bits (58), Expect = 6.3 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 29 WIPRAAG-DYEIEYKKGKLNCNADSLSRNLVHTLDEPTGLQPPPYL 163 W+ A D I Y++GK N +AD LSR + EPT YL Sbjct: 772 WLSALAPFDITITYRQGKSNGDADGLSR-IPREGSEPTPEDKEDYL 816 >SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1831 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 74 PFCIQSRSRLQPGGSTSLE 18 PFC Q L+PGGS S+E Sbjct: 33 PFCSQHCQTLEPGGSCSVE 51 >SB_57833| Best HMM Match : RnaseH (HMM E-Value=0.18) Length = 366 Score = 27.5 bits (58), Expect = 6.3 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 29 WIPRAAG-DYEIEYKKGKLNCNADSLSRNLVHTLDEPTGLQPPPYL 163 W+ A D I Y++GK N +AD LSR + EPT YL Sbjct: 235 WLSALAPFDITITYRQGKSNGDADGLSR-IPREGSEPTPEDKEDYL 279 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 2/20 (10%) Frame = -2 Query: 61 NLVVA--CSPGDPLV*SAPP 8 N++++ CSPGDPLV PP Sbjct: 12 NIIISNSCSPGDPLVLERPP 31 >SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.5 bits (58), Expect = 6.3 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 70 FVFNLVVACSPGDPLV*SAPP 8 F L +CSPGDPLV PP Sbjct: 7 FTCALSNSCSPGDPLVLERPP 27 >SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.5 bits (58), Expect = 6.3 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -2 Query: 88 TI*LPLFVFNLVVACSPGDPLV*SAPP 8 T+ +PL + +CSPGDPLV PP Sbjct: 10 TVLVPLTILGSN-SCSPGDPLVLERPP 35 >SB_45924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 67 VFNLVVACSPGDPLV*SAPP 8 V L+ +CS GDPLV PP Sbjct: 44 VIELIESCSTGDPLVLERPP 63 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 27.5 bits (58), Expect = 6.3 Identities = 18/64 (28%), Positives = 24/64 (37%), Gaps = 4/64 (6%) Frame = +2 Query: 128 DEPTGLQPPPYLDEQSRVDEPLT----FDDLSPLPPPIDFNAPGSVPSENPLGQEMPSHP 295 + P L PPP + +R P T P PPP P +P+ +P P Sbjct: 917 EPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPLP 976 Query: 296 TQPP 307 PP Sbjct: 977 PPPP 980 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 2425 SCSPGDPLVLERPP 2438 >SB_44757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 789 Score = 27.5 bits (58), Expect = 6.3 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +2 Query: 41 AAGDYEIEYKKGKLNCNADSLSRNLVH--TLDEPTGLQPPPYLDEQSRVDEPLTFDDLS 211 A+ Y++ Y+KG + NAD LSR V + E T + Y+D D P+T D++ Sbjct: 544 ASHQYDVVYRKGVDHSNADGLSRLPVDKPRVSEETEIYHFSYVD-----DLPVTAKDIA 597 >SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 64 FNLVVACSPGDPLV*SAPP 8 F+ +CSPGDPLV PP Sbjct: 5 FHASNSCSPGDPLVLERPP 23 >SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 6.3 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 76 PLFVFNLVVACSPGDPLV*SAPP 8 PL + +CSPGDPLV PP Sbjct: 8 PLMFTDPSNSCSPGDPLVLERPP 30 >SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 27.5 bits (58), Expect = 6.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 67 VFNLVVACSPGDPLV*SAPP 8 V +L +CSPGDPLV PP Sbjct: 44 VQSLSNSCSPGDPLVLERPP 63 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 67 VFNLVVACSPGDPLV*SAPP 8 V + +CSPGDPLV PP Sbjct: 2 VLGISNSCSPGDPLVLERPP 21 >SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) Length = 274 Score = 27.5 bits (58), Expect = 6.3 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 67 VFNLVVACSPGDPLV*SAPP 8 V N +CSPGDPLV PP Sbjct: 147 VANSSNSCSPGDPLVLERPP 166 >SB_28642| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) Length = 1750 Score = 27.5 bits (58), Expect = 6.3 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +2 Query: 41 AAGDYEIEYKKGKLNCNADSLSRNLVH--TLDEPTGLQPPPYLDEQSRVDEPLTFDDLS 211 A+ Y++ Y+KG + NAD LSR V + E T + Y+D D P+T D++ Sbjct: 800 ASHQYDVVYRKGVDHSNADGLSRLPVDKPRVSEETEIYHFSYVD-----DLPVTAKDIA 853 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 27.5 bits (58), Expect = 6.3 Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = -3 Query: 294 GWLGISCP---RGFSEGTEPGALKSMGGGNGDKSSN 196 GW+G G++ G PGA+ GGG G N Sbjct: 201 GWVGGRAGGMNSGYNGGPAPGAVGGFGGGGGGSEDN 236 >SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) Length = 167 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 67 VFNLVVACSPGDPLV*SAPP 8 + N +CSPGDPLV PP Sbjct: 40 LLNASNSCSPGDPLVLERPP 59 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 6.3 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 4/25 (16%) Frame = -2 Query: 70 FVFNLVV----ACSPGDPLV*SAPP 8 FVF + + +CSPGDPLV PP Sbjct: 6 FVFRVTLEVSNSCSPGDPLVLERPP 30 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.5 bits (58), Expect = 6.3 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 3/25 (12%) Frame = -2 Query: 73 LFVFNLVV---ACSPGDPLV*SAPP 8 LF+ N ++ +CSPGDPLV PP Sbjct: 47 LFIENRLMRSNSCSPGDPLVLERPP 71 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 67 VFNLVVACSPGDPLV*SAPP 8 V + +CSPGDPLV PP Sbjct: 87 VMTISNSCSPGDPLVLERPP 106 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.5 bits (58), Expect = 6.3 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -2 Query: 79 LPLFVFNLVVACSPGDPLV*SAPP 8 LPL N +CSPGDPLV PP Sbjct: 25 LPLVPSN---SCSPGDPLVLERPP 45 >SB_13608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 587 Score = 27.5 bits (58), Expect = 6.3 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 167 EQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSENPLG 274 ++SR +PL S +P +D+N P S S P G Sbjct: 531 QRSRTPQPLDLP-CSTMPKRLDYNRPKSASSPTPTG 565 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 27.5 bits (58), Expect = 6.3 Identities = 16/56 (28%), Positives = 23/56 (41%) Frame = +2 Query: 140 GLQPPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSENPLGQEMPSHPTQPP 307 G+ PPP P T ++ P PPP + P P+ P P++ PP Sbjct: 343 GVNPPPPPTNNPPSPPPPT-NNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPP 397 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 14 SCSPGDPLVLERPP 27 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 12 SCSPGDPLVLERPP 25 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 37 SCSPGDPLVLERPP 50 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 28 SCSPGDPLVLERPP 41 >SB_58829| Best HMM Match : HC2 (HMM E-Value=5.8) Length = 959 Score = 27.1 bits (57), Expect = 8.3 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = -3 Query: 255 GTEPGALKSMGGGNGDKSSNV----RGSSTRDCSSRYGGGCKPVGSSRV*TRLRDK 100 G + + G NG+ + RG TRDC + G G K + + TR+R + Sbjct: 396 GQTGNGYERLHGANGEWIQEIAWGKRGMDTRDCMGQTGNGYKRLHGASHNTRVRTR 451 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 5 SCSPGDPLVLERPP 18 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 20 SCSPGDPLVLERPP 33 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 29 SCSPGDPLVLERPP 42 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 186 SCSPGDPLVLERPP 199 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 81 SCSPGDPLVLERPP 94 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 17 SCSPGDPLVLERPP 30 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 9 SCSPGDPLVLERPP 22 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 8 SCSPGDPLVLERPP 21 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 20 SCSPGDPLVLERPP 33 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 29 SCSPGDPLVLERPP 42 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 13 SCSPGDPLVLERPP 26 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 104 SCSPGDPLVLERPP 117 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 9 SCSPGDPLVLERPP 22 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 37 SCSPGDPLVLERPP 50 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 6 SCSPGDPLVLERPP 19 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 84 SCSPGDPLVLERPP 97 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 4 SCSPGDPLVLERPP 17 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 518 SCSPGDPLVLERPP 531 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 384 SCSPGDPLVLERPP 397 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 26 SCSPGDPLVLERPP 39 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 16 SCSPGDPLVLERPP 29 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 24 SCSPGDPLVLERPP 37 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 33 SCSPGDPLVLERPP 46 >SB_52986| Best HMM Match : zf-C2H2 (HMM E-Value=0.0042) Length = 623 Score = 27.1 bits (57), Expect = 8.3 Identities = 20/71 (28%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Frame = +2 Query: 104 SRNLVHTLD-EPTGLQPPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSENPLGQE 280 S N H D +P G+ D Q+ V L P PP + + PG++ + P Q+ Sbjct: 331 SSNRRHRRDRKPQGISNQEQRDIQAAVKSSLESAPRKPSPPIPEESPPGAMAAPIPT-QD 389 Query: 281 MPSHPTQPPTK 313 +P+ P +K Sbjct: 390 NNHYPSLPGSK 400 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 4 SCSPGDPLVLERPP 17 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 10 SCSPGDPLVLERPP 23 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 24 SCSPGDPLVLERPP 37 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 21 SCSPGDPLVLERPP 34 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 5 SCSPGDPLVLERPP 18 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 19 SCSPGDPLVLERPP 32 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 9 SCSPGDPLVLERPP 22 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 56 SCSPGDPLVLERPP 69 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 6 SCSPGDPLVLERPP 19 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 264 SCSPGDPLVLERPP 277 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 27 SCSPGDPLVLERPP 40 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 27.1 bits (57), Expect = 8.3 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = +2 Query: 134 PTGLQPPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSV--PSENPLGQEMPSHPTQPP 307 PTG+ P + + + P +++S LPPP D + P S P+ +P P P+ PP Sbjct: 707 PTGIDIP-HSPSKDDLPLPPPPEEVS-LPPP-DESPPSSKHPPTVSPSSSSAPPRPSTPP 763 Query: 308 T 310 + Sbjct: 764 S 764 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 13 SCSPGDPLVLERPP 26 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 13 SCSPGDPLVLERPP 26 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 21 SCSPGDPLVLERPP 34 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 15 SCSPGDPLVLERPP 28 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 165 SCSPGDPLVLERPP 178 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 22 SCSPGDPLVLERPP 35 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 23 SCSPGDPLVLERPP 36 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 19 SCSPGDPLVLERPP 32 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 37 SCSPGDPLVLERPP 50 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 20 SCSPGDPLVLERPP 33 >SB_47964| Best HMM Match : Abi_HHR (HMM E-Value=5) Length = 275 Score = 27.1 bits (57), Expect = 8.3 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +2 Query: 41 AAGDYEIEYKKGKLNCNADSLSRNLVH--TLDEPTGLQPPPYLDE 169 A+ Y++ Y+KG + NAD LSR V + E T + Y+D+ Sbjct: 22 ASHQYDVVYRKGVDHSNADGLSRLPVDKPRVSEETEIYHFSYVDD 66 >SB_47416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1413 Score = 27.1 bits (57), Expect = 8.3 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +2 Query: 41 AAGDYEIEYKKGKLNCNADSLSRNLVH--TLDEPTGLQPPPYLDE 169 A+ Y++ Y+KG + NAD LSR V + E T + Y+D+ Sbjct: 783 ASHQYDVVYRKGVDHSNADGLSRLPVDKPRVSEETEIYHFSYVDD 827 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 66 SCSPGDPLVLERPP 79 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 19 SCSPGDPLVLERPP 32 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 18 SCSPGDPLVLERPP 31 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 7 SCSPGDPLVLERPP 20 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 6 SCSPGDPLVLERPP 19 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 13 SCSPGDPLVLERPP 26 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 50 SCSPGDPLVLERPP 63 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 15 SCSPGDPLVLERPP 28 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 115 SCSPGDPLVLERPP 128 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 895 SCSPGDPLVLERPP 908 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 16 SCSPGDPLVLERPP 29 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 27 SCSPGDPLVLERPP 40 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 16 SCSPGDPLVLERPP 29 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 45 SCSPGDPLVLERPP 58 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 96 SCSPGDPLVLERPP 109 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 67 SCSPGDPLVLERPP 80 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 17 SCSPGDPLVLERPP 30 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 878 SCSPGDPLVLERPP 891 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 13 SCSPGDPLVLERPP 26 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 65 SCSPGDPLVLERPP 78 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 7 SCSPGDPLVLERPP 20 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 20 SCSPGDPLVLERPP 33 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 22 SCSPGDPLVLERPP 35 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 66 SCSPGDPLVLERPP 79 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 45 SCSPGDPLVLERPP 58 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 28 SCSPGDPLVLERPP 41 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 41 SCSPGDPLVLERPP 54 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 17 SCSPGDPLVLERPP 30 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 23 SCSPGDPLVLERPP 36 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 26 SCSPGDPLVLERPP 39 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 43 SCSPGDPLVLERPP 56 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 5 SCSPGDPLVLERPP 18 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 42 SCSPGDPLVLERPP 55 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 27 SCSPGDPLVLERPP 40 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 17 SCSPGDPLVLERPP 30 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 144 SCSPGDPLVLERPP 157 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 485 SCSPGDPLVLERPP 498 >SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 4 SCSPGDPLVLERPP 17 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 37 SCSPGDPLVLERPP 50 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 83 SCSPGDPLVLERPP 96 >SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 63 SCSPGDPLVLERPP 76 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 26 SCSPGDPLVLERPP 39 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 6 SCSPGDPLVLERPP 19 >SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 6 SCSPGDPLVLERPP 19 >SB_35833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1032 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/28 (39%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 29 WIPRAAG-DYEIEYKKGKLNCNADSLSR 109 W+ A ++ I+Y+ G+ N +AD+LSR Sbjct: 218 WVAELADYNFTIKYRPGRTNIDADTLSR 245 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 56 SCSPGDPLVLERPP 69 >SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 9 SCSPGDPLVLERPP 22 >SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 4 SCSPGDPLVLERPP 17 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 25 SCSPGDPLVLERPP 38 >SB_33542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1182 Score = 27.1 bits (57), Expect = 8.3 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 110 CEIRNLRYNLTSPFCIQSRSRLQPGGSTSLER 15 CE+R+ R + I+ RLQ G ST+L R Sbjct: 828 CEVRDTRATMLDMAKIRYTRRLQEGASTALTR 859 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 24 SCSPGDPLVLERPP 37 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 36 SCSPGDPLVLERPP 49 >SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 4 SCSPGDPLVLERPP 17 >SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) Length = 327 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 206 SCSPGDPLVLERPP 219 >SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 49 SCSPGDPLVLERPP 62 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 16 SCSPGDPLVLERPP 29 >SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 4 SCSPGDPLVLERPP 17 >SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 5 SCSPGDPLVLERPP 18 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 1024 SCSPGDPLVLERPP 1037 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 19 SCSPGDPLVLERPP 32 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 19 SCSPGDPLVLERPP 32 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 123 SCSPGDPLVLERPP 136 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 19 SCSPGDPLVLERPP 32 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 6 SCSPGDPLVLERPP 19 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 49 ACSPGDPLV*SAPP 8 +CSPGDPLV PP Sbjct: 25 SCSPGDPLVLERPP 38 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,185,276 Number of Sequences: 59808 Number of extensions: 342698 Number of successful extensions: 3571 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3311 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3542 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1038380485 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -