BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0560 (488 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-b... 27 0.34 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 26 0.80 CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 25 1.4 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 24 3.2 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 24 3.2 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 4.2 CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 23 5.6 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 5.6 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 23 5.6 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 23 5.6 X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 23 7.4 AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 23 7.4 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 23 7.4 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 22 9.8 DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 22 9.8 >AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-binding protein OBPjj16 protein. Length = 198 Score = 27.1 bits (57), Expect = 0.34 Identities = 17/54 (31%), Positives = 24/54 (44%) Frame = +2 Query: 152 PPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSENPLGQEMPSHPTQPPTK 313 PP D +T +D +P PID +ENP +MP+ P P T+ Sbjct: 19 PPAPDASCFQPTAVTAEDCCKIPKPIDNAIMEKCRAENPKPGQMPA-PGVPRTE 71 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 25.8 bits (54), Expect = 0.80 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 221 PPIDFNAPGSVPSENPLGQEMPSHPTQPPT 310 PP +F PG P +G+ S+P++PP+ Sbjct: 381 PPRNFTMPGPGPG---IGEREKSNPSRPPS 407 Score = 25.0 bits (52), Expect = 1.4 Identities = 15/54 (27%), Positives = 22/54 (40%) Frame = +2 Query: 140 GLQPPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSENPLGQEMPSHPTQ 301 G+Q PP + + + P P P + N G +PS +G P P Q Sbjct: 253 GMQRPPMMGQPPPIRPPNPMGGPRPQISPQNSNLSGGMPS-GMVGPPRPPMPMQ 305 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 25.0 bits (52), Expect = 1.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 212 PLPPPIDFNAPGSVPSENPLGQEMPSHPTQ 301 P P PI P S+ + N L +P+H +Q Sbjct: 189 PAPVPIVTPVPRSLRTNNVLNTSIPNHGSQ 218 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.8 bits (49), Expect = 3.2 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = -3 Query: 267 GFSEGTEPGALKSMGGGNGDKSSNVRGSSTRDCSSRYGGGCKPVG 133 G G GA S G G G S + G S +GG G Sbjct: 677 GGGSGAGGGAGSSGGSGGGLASGSPYGGGGHHLSHHHGGAAAATG 721 Score = 23.4 bits (48), Expect = 4.2 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -3 Query: 261 SEGTEPGALKSMGGGNGDKSSNVRGSSTRDCSSRYGGG 148 + G A+ + GGG G S V GS T GGG Sbjct: 505 ASGVVVNAVLAAGGGGGG-SGCVNGSRTVGAGGMAGGG 541 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 23.8 bits (49), Expect = 3.2 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +2 Query: 83 NCNADSLSRNLVHTLDEPTGLQPPPYLDEQS 175 + NA R HT PPP+LD++S Sbjct: 829 SANAMHPPRGSRHTRQGSEASSPPPFLDDRS 859 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.4 bits (48), Expect = 4.2 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = -3 Query: 225 GGGNGDKSSNVRGSSTR--DCSSRYGGG 148 GGGNG+++ + +T D S++GGG Sbjct: 2030 GGGNGNENDDSGDGATGSGDNGSQHGGG 2057 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 23.0 bits (47), Expect = 5.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -3 Query: 294 GWLGISCPRGF 262 GWL I PRGF Sbjct: 280 GWLDIEIPRGF 290 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.0 bits (47), Expect = 5.6 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = +2 Query: 149 PPPYLDEQSRVDEPLTFDDLSPLPPPIDFNAPGSVPSENPLGQEMPSHP 295 PPP + QS+ EP LPP D + S PS +++P P Sbjct: 643 PPPRTNSQSQASEP-----TPALPPRADRD---SKPSSRDRPKDLPPPP 683 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 23.0 bits (47), Expect = 5.6 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = -3 Query: 270 RGFSEGTEPGALKSMGG--GNGDKSSNVR 190 RGFS G E G +S+G N ++ N+R Sbjct: 5 RGFSVGDELGLAESLGNVEANKRRALNIR 33 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.0 bits (47), Expect = 5.6 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -3 Query: 267 GFSEGTEPGALKSMGGGNGDKSSNV 193 G S G PGA + GG+G S + Sbjct: 84 GLSHGPSPGAGGTGSGGSGGGSGGI 108 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 22.6 bits (46), Expect = 7.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 236 NAPGSVPSENPLGQEMPSHPTQP 304 N PG PS NP Q P QP Sbjct: 413 NEPGDSPSHNPSNQ-YQLQPMQP 434 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 22.6 bits (46), Expect = 7.4 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = -3 Query: 222 GGNGDKSSNVRGSSTRDCSSRYGGG 148 GG G RG RD +GGG Sbjct: 73 GGRGGGRGRGRGRGGRDGGGGFGGG 97 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 22.6 bits (46), Expect = 7.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 255 GTEPGALKSMGGGNGDKSSNVR 190 G+ G + S+GGG G S+VR Sbjct: 728 GSIGGEVGSVGGGGGGGGSSVR 749 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 22.2 bits (45), Expect = 9.8 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +2 Query: 218 PPPIDFNAPGSVPSENPLGQEMPSHPTQP 304 PPP P S + PLG S P P Sbjct: 586 PPPPPMGPPPSPLAGGPLGGPAGSRPPLP 614 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 22.2 bits (45), Expect = 9.8 Identities = 10/29 (34%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +2 Query: 221 PPIDFNAPGSVPSENPLGQEMPS-HPTQP 304 P PG+V S++ G MP P +P Sbjct: 140 PGTQMGGPGTVESQDLFGDMMPQPQPARP 168 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 508,721 Number of Sequences: 2352 Number of extensions: 10687 Number of successful extensions: 34 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43131618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -