BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0557 (620 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1779 - 29458889-29459249,29461107-29461283,29461374-294615... 28 6.9 03_05_0863 + 28357585-28357635,28357782-28357851,28357987-283580... 28 6.9 >07_03_1779 - 29458889-29459249,29461107-29461283,29461374-29461573, 29461673-29462752 Length = 605 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 491 YSVRTREIIWRPLSKSSRSPKFIKY*VFTGDVIYLKGLYV 610 +SVR R I WR ++K + + K + Y VF + +L + Sbjct: 385 HSVRDRVIAWRSIAKHAANWKGVHYLVFNTYIWWLNNFQI 424 >03_05_0863 + 28357585-28357635,28357782-28357851,28357987-28358054, 28358757-28358818,28359491-28359572,28359658-28359891, 28360210-28360338,28360430-28360491,28360779-28360896 Length = 291 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -2 Query: 334 VWSLKEKNLYFCRIFYWK*IFVAITTIEVVIVWIML 227 +WS YF IF W IFVA T + W+++ Sbjct: 177 LWSYTRHPNYFGEIFLWWGIFVASTPVLSGAEWLVI 212 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,539,394 Number of Sequences: 37544 Number of extensions: 211181 Number of successful extensions: 273 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 264 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 273 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1502076244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -