BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0555 (406 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20583| Best HMM Match : RCC1 (HMM E-Value=6.2e-08) 40 8e-04 SB_18907| Best HMM Match : RCC1 (HMM E-Value=0) 38 0.002 SB_30518| Best HMM Match : FYVE (HMM E-Value=1.2e-18) 38 0.003 SB_59432| Best HMM Match : MORN (HMM E-Value=9.3e-26) 38 0.004 SB_45009| Best HMM Match : RCC1 (HMM E-Value=7.6e-21) 37 0.005 SB_17186| Best HMM Match : RCC1 (HMM E-Value=1.5e-19) 36 0.010 SB_2363| Best HMM Match : RCC1 (HMM E-Value=0.00041) 36 0.010 SB_46796| Best HMM Match : RCC1 (HMM E-Value=3e-14) 34 0.051 SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) 33 0.067 SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.20 SB_29134| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.27 SB_25012| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.27 SB_10740| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.27 SB_6739| Best HMM Match : RCC1 (HMM E-Value=1.6e-34) 30 0.62 SB_7970| Best HMM Match : RCC1 (HMM E-Value=0) 30 0.82 SB_52263| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.1 SB_5067| Best HMM Match : RCC1 (HMM E-Value=4.5e-16) 29 1.9 SB_42507| Best HMM Match : ResIII (HMM E-Value=0.75) 29 1.9 SB_49438| Best HMM Match : LIM (HMM E-Value=3.1) 28 2.5 SB_29698| Best HMM Match : DUF1610 (HMM E-Value=4.6) 28 2.5 SB_25283| Best HMM Match : LIM (HMM E-Value=1.1) 28 2.5 SB_23543| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.5 SB_23438| Best HMM Match : zf-CCHC (HMM E-Value=0.00065) 28 2.5 SB_10205| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.5 SB_12073| Best HMM Match : LIM (HMM E-Value=0.49) 28 3.3 SB_16849| Best HMM Match : RmlD_sub_bind (HMM E-Value=3.3) 28 3.3 SB_52418| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.4 SB_32347| Best HMM Match : RCC1 (HMM E-Value=0.00072) 27 4.4 SB_42659| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.8 SB_33372| Best HMM Match : LRV (HMM E-Value=7) 27 5.8 SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.8 SB_14412| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.8 SB_1228| Best HMM Match : PKD_channel (HMM E-Value=0) 27 5.8 SB_56605| Best HMM Match : WD40 (HMM E-Value=2.5e-12) 27 5.8 SB_48227| Best HMM Match : DEAD (HMM E-Value=1.6) 27 5.8 SB_12490| Best HMM Match : DEAD (HMM E-Value=1.6) 27 5.8 SB_12136| Best HMM Match : ResIII (HMM E-Value=0.24) 27 5.8 SB_58837| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_58231| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_57874| Best HMM Match : LIM (HMM E-Value=0.44) 27 7.7 SB_56636| Best HMM Match : Toxin_4 (HMM E-Value=2.4) 27 7.7 SB_56579| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_56070| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_55623| Best HMM Match : ResIII (HMM E-Value=0.17) 27 7.7 SB_53418| Best HMM Match : zf-CCHC (HMM E-Value=8.2) 27 7.7 SB_53009| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_48939| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_48848| Best HMM Match : DUF1213 (HMM E-Value=8) 27 7.7 SB_42413| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_40361| Best HMM Match : ResIII (HMM E-Value=0.42) 27 7.7 SB_38724| Best HMM Match : DUF1684 (HMM E-Value=2.2) 27 7.7 SB_37849| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_36713| Best HMM Match : ResIII (HMM E-Value=1) 27 7.7 SB_36584| Best HMM Match : ResIII (HMM E-Value=0.95) 27 7.7 SB_34067| Best HMM Match : SPAN-X (HMM E-Value=2.7) 27 7.7 SB_33051| Best HMM Match : PADR1 (HMM E-Value=1.2) 27 7.7 SB_32248| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_31605| Best HMM Match : ResIII (HMM E-Value=0.44) 27 7.7 SB_31020| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_30838| Best HMM Match : ResIII (HMM E-Value=0.13) 27 7.7 SB_29680| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_25765| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_25687| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_25225| Best HMM Match : DEAD (HMM E-Value=1.4) 27 7.7 SB_24603| Best HMM Match : GatB_Yqey (HMM E-Value=0.7) 27 7.7 SB_22826| Best HMM Match : F5_F8_type_C (HMM E-Value=7.9e-09) 27 7.7 SB_21868| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_20530| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_19858| Best HMM Match : DEAD (HMM E-Value=0.61) 27 7.7 SB_18996| Best HMM Match : zf-C4_Topoisom (HMM E-Value=3.5) 27 7.7 SB_17225| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_16351| Best HMM Match : LIM (HMM E-Value=8.8) 27 7.7 SB_15676| Best HMM Match : ResIII (HMM E-Value=4.5) 27 7.7 SB_15299| Best HMM Match : LIM (HMM E-Value=0.44) 27 7.7 SB_14541| Best HMM Match : ResIII (HMM E-Value=0.66) 27 7.7 SB_13306| Best HMM Match : PADR1 (HMM E-Value=1.2) 27 7.7 SB_12992| Best HMM Match : LIM (HMM E-Value=0.16) 27 7.7 SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_7382| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_7068| Best HMM Match : ResIII (HMM E-Value=0.29) 27 7.7 SB_5396| Best HMM Match : DEAD (HMM E-Value=0.73) 27 7.7 SB_3753| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_3590| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_3096| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_1473| Best HMM Match : DUF551 (HMM E-Value=1.6) 27 7.7 SB_474| Best HMM Match : dsrm (HMM E-Value=3.2e-20) 27 7.7 SB_366| Best HMM Match : ResIII (HMM E-Value=0.28) 27 7.7 SB_59747| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_59553| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_58744| Best HMM Match : ResIII (HMM E-Value=0.14) 27 7.7 SB_56794| Best HMM Match : ResIII (HMM E-Value=0.63) 27 7.7 SB_53226| Best HMM Match : ResIII (HMM E-Value=0.45) 27 7.7 SB_53060| Best HMM Match : ResIII (HMM E-Value=0.14) 27 7.7 SB_51131| Best HMM Match : ResIII (HMM E-Value=0.36) 27 7.7 SB_49508| Best HMM Match : ResIII (HMM E-Value=1.3) 27 7.7 SB_48412| Best HMM Match : ResIII (HMM E-Value=0.19) 27 7.7 SB_48295| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_46734| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_46041| Best HMM Match : LIM (HMM E-Value=1.5) 27 7.7 SB_45084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_44949| Best HMM Match : LIM (HMM E-Value=0.44) 27 7.7 SB_43215| Best HMM Match : ResIII (HMM E-Value=7.9) 27 7.7 SB_39998| Best HMM Match : Peptidase_C1 (HMM E-Value=0) 27 7.7 SB_39663| Best HMM Match : ResIII (HMM E-Value=1.1) 27 7.7 SB_38419| Best HMM Match : ResIII (HMM E-Value=0.48) 27 7.7 SB_37597| Best HMM Match : ResIII (HMM E-Value=0.28) 27 7.7 SB_37416| Best HMM Match : ResIII (HMM E-Value=1.2) 27 7.7 SB_36888| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_36328| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) 27 7.7 SB_35990| Best HMM Match : ResIII (HMM E-Value=2) 27 7.7 SB_34841| Best HMM Match : ResIII (HMM E-Value=1.6) 27 7.7 SB_32075| Best HMM Match : LIM (HMM E-Value=0.44) 27 7.7 SB_31943| Best HMM Match : ResIII (HMM E-Value=1.6) 27 7.7 SB_31820| Best HMM Match : CG-1 (HMM E-Value=2.4) 27 7.7 SB_31538| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_31160| Best HMM Match : FeThRed_B (HMM E-Value=4.1) 27 7.7 SB_31030| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_29335| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_27544| Best HMM Match : ResIII (HMM E-Value=0.14) 27 7.7 SB_27423| Best HMM Match : ResIII (HMM E-Value=0.56) 27 7.7 SB_27319| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_27311| Best HMM Match : DEAD (HMM E-Value=0.17) 27 7.7 SB_27173| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_25592| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_24587| Best HMM Match : ResIII (HMM E-Value=0.82) 27 7.7 SB_24295| Best HMM Match : DUF1070 (HMM E-Value=3.9) 27 7.7 SB_24250| Best HMM Match : ResIII (HMM E-Value=3.6) 27 7.7 SB_23847| Best HMM Match : Steroid_dh (HMM E-Value=1.9) 27 7.7 SB_16070| Best HMM Match : IncA (HMM E-Value=0.43) 27 7.7 SB_15115| Best HMM Match : ResIII (HMM E-Value=0.24) 27 7.7 SB_13172| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_12717| Best HMM Match : CheR (HMM E-Value=5.6) 27 7.7 SB_12589| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_11769| Best HMM Match : Complex1_17_2kD (HMM E-Value=6.6) 27 7.7 SB_7073| Best HMM Match : ResIII (HMM E-Value=0.083) 27 7.7 SB_7013| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_5569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_5505| Best HMM Match : ResIII (HMM E-Value=0.55) 27 7.7 SB_3287| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_2770| Best HMM Match : ResIII (HMM E-Value=2.2) 27 7.7 SB_2121| Best HMM Match : ResIII (HMM E-Value=0.46) 27 7.7 SB_2065| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_1431| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_204| Best HMM Match : ResIII (HMM E-Value=1.2) 27 7.7 >SB_20583| Best HMM Match : RCC1 (HMM E-Value=6.2e-08) Length = 970 Score = 39.9 bits (89), Expect = 8e-04 Identities = 18/32 (56%), Positives = 21/32 (65%) Frame = +2 Query: 212 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 307 + VAAGRAH+ LT VYT G+N YGQ G Sbjct: 231 VSQVAAGRAHSAFLTKDGCVYTCGSNQYGQLG 262 Score = 26.6 bits (56), Expect = 7.7 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 5/54 (9%) Frame = +2 Query: 161 LLSYAP----IYIPYKSLECEIKA-VAAGRAHTIILTDKEGVYTLGNNAYGQCG 307 + S+AP + + ++ L+ +I +A G H LTD + T G +GQ G Sbjct: 471 VFSWAPFSGDVVLLHRELDSKIIVQIACGAFHVAALTDSGELLTCGTGKHGQLG 524 >SB_18907| Best HMM Match : RCC1 (HMM E-Value=0) Length = 444 Score = 38.3 bits (85), Expect = 0.002 Identities = 36/134 (26%), Positives = 59/134 (44%) Frame = +2 Query: 5 GIRHEDTNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHSPRRNHPLELLLSYAPIY 184 G++ +D + CG T KT V+ G+N Q+G + H + S + + Sbjct: 254 GLKFKD--VFCGSFATFVVAKTGSD--VYAWGLNNYGQLGTGDVQTWHFPVKVKSLSQLN 309 Query: 185 IPYKSLECEIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCGRKVNVNEEYKGSMVTHNIQ 364 KS + + +A G+ HTI+ VY LG YG+ G + + K + + +I Sbjct: 310 ---KSEKDKHITIANGQHHTIVCDPNGKVYALGRADYGRLG----LGDGAKETALPAHIT 362 Query: 365 KLGKESIIDVCCGQ 406 L E I V CG+ Sbjct: 363 SLDNEVIEKVACGE 376 Score = 29.1 bits (62), Expect = 1.4 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 221 VAAGRAHTIILTDKEGVYTLGNNAYGQCGR 310 +A+G HT LT ++TLG GQ GR Sbjct: 197 IASGNDHTAALTTSGNLFTLGCAEQGQLGR 226 Score = 27.9 bits (59), Expect = 3.3 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +2 Query: 212 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCGRKVNV--NEEYKGSMVT 352 I V +G HT+ L+ VYT G N G GR+ EE++ +V+ Sbjct: 85 IVQVESGGMHTVALSKDGKVYTWGCNDDGALGRETTSEGEEEFQPGVVS 133 >SB_30518| Best HMM Match : FYVE (HMM E-Value=1.2e-18) Length = 447 Score = 37.9 bits (84), Expect = 0.003 Identities = 19/53 (35%), Positives = 30/53 (56%) Frame = +2 Query: 203 ECEIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCGRKVNVNEEYKGSMVTHNI 361 E +I VA G H+ L +K ++ G+N YGQ G +N N++ VT+N+ Sbjct: 274 EHKISRVACGSFHSAALAEKGRMFCCGDNTYGQLGAHLNDNQD---DHVTYNV 323 >SB_59432| Best HMM Match : MORN (HMM E-Value=9.3e-26) Length = 1362 Score = 37.5 bits (83), Expect = 0.004 Identities = 26/98 (26%), Positives = 43/98 (43%) Frame = +2 Query: 14 HEDTNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHSPRRNHPLELLLSYAPIYIPY 193 H + +A G TV + H+VF G N Q+G+ R P +P+ Sbjct: 36 HGISKVALGTAHTVL---LTFNHEVFAFGDNNFGQLGFGDRNRRRD--------PAKLPF 84 Query: 194 KSLECEIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 307 + + +A G H+++L D Y G+++ GQCG Sbjct: 85 FEGK-RVVDIACGGQHSVVLLDNGETYAWGDSSSGQCG 121 Score = 36.3 bits (80), Expect = 0.010 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = +2 Query: 197 SLECEIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 307 SL I VA G AHT++LT V+ G+N +GQ G Sbjct: 33 SLPHGISKVALGTAHTVLLTFNHEVFAFGDNNFGQLG 69 >SB_45009| Best HMM Match : RCC1 (HMM E-Value=7.6e-21) Length = 595 Score = 37.1 bits (82), Expect = 0.005 Identities = 24/80 (30%), Positives = 43/80 (53%) Frame = +2 Query: 164 LSYAPIYIPYKSLECEIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCGRKVNVNEEYKGS 343 +S PI P ++ ++ V+ G++H ++T + YT G+N+ GQ G+ VN + K + Sbjct: 73 VSMFPIETPVRA---QLGEVSVGQSHVAVVTLERAAYTWGDNSRGQLGQGDLVNRD-KPT 128 Query: 344 MVTHNIQKLGKESIIDVCCG 403 +V L ++I CCG Sbjct: 129 LV----DTLKGKAITRACCG 144 >SB_17186| Best HMM Match : RCC1 (HMM E-Value=1.5e-19) Length = 637 Score = 36.3 bits (80), Expect = 0.010 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +2 Query: 221 VAAGRAHTIILTDKEGVYTLGNNAYGQCGR 310 ++ G +H + LT VY GNN+ GQCG+ Sbjct: 567 ISVGDSHCVALTQDNNVYAWGNNSMGQCGQ 596 Score = 28.7 bits (61), Expect = 1.9 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = +2 Query: 203 ECEIKAVAAGRA---HTIILTDKEGVYTLGNNAYGQCG 307 EC +K+V++ + HT+ LT VY+ G+ YG+ G Sbjct: 381 ECLVKSVSSSKGSDGHTLALTLDGKVYSWGDGDYGKLG 418 Score = 27.5 bits (58), Expect = 4.4 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 221 VAAGRAHTIILTDKEGVYTLGNNAYGQCG 307 +AAG H+ +T+ +YT G YG+ G Sbjct: 443 IAAGYRHSAAVTEDGELYTWGEGDYGRLG 471 >SB_2363| Best HMM Match : RCC1 (HMM E-Value=0.00041) Length = 234 Score = 36.3 bits (80), Expect = 0.010 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +2 Query: 221 VAAGRAHTIILTDKEGVYTLGNNAYGQCGR 310 ++ G +H + LT VY GNN+ GQCG+ Sbjct: 64 ISVGDSHCVALTQDNNVYAWGNNSMGQCGQ 93 >SB_46796| Best HMM Match : RCC1 (HMM E-Value=3e-14) Length = 350 Score = 33.9 bits (74), Expect = 0.051 Identities = 20/64 (31%), Positives = 30/64 (46%) Frame = +2 Query: 212 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCGRKVNVNEEYKGSMVTHNIQKLGKESIID 391 I + GR HT+ILTD V+ G+N GQ G+ +++ I + + Sbjct: 30 IVQASCGRGHTLILTDAGLVFGFGDNKLGQIGQG---HQKPTSLPCPLQIMHPTDKKVTK 86 Query: 392 VCCG 403 VCCG Sbjct: 87 VCCG 90 Score = 30.7 bits (66), Expect = 0.47 Identities = 18/60 (30%), Positives = 29/60 (48%) Frame = +2 Query: 209 EIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCGRKVNVNEEYKGSMVTHNIQKLGKESII 388 +IK V G HT+ L ++ V+T G YG+ G + +E + N + G S+I Sbjct: 159 KIKDVVCGNNHTMALDEQGRVFTWGFGGYGRLGHQQPKDEHVPRLLTFFNTK--GNPSVI 216 >SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) Length = 964 Score = 33.5 bits (73), Expect = 0.067 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +2 Query: 218 AVAAGRAHTIILTDKEGVYTLGNNAYGQCG 307 +VA G +HT++L +Y+ G+N++GQ G Sbjct: 587 SVAMGTSHTLVLLQNGKLYSFGSNSFGQLG 616 >SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3592 Score = 31.9 bits (69), Expect = 0.20 Identities = 15/61 (24%), Positives = 30/61 (49%) Frame = +2 Query: 221 VAAGRAHTIILTDKEGVYTLGNNAYGQCGRKVNVNEEYKGSMVTHNIQKLGKESIIDVCC 400 ++ G +H+ +T +YT G YG+ G + + + ++ ++ L +IDV C Sbjct: 2524 ISCGGSHSACITQNHELYTWGKGRYGRLG-----HGDSEDQLLPKVVEALRGNRVIDVAC 2578 Query: 401 G 403 G Sbjct: 2579 G 2579 Score = 31.5 bits (68), Expect = 0.27 Identities = 25/107 (23%), Positives = 44/107 (41%) Frame = +2 Query: 83 KVFGTGINTDSQIGYHSPRRNHPLELLLSYAPIYIPYKSLECEIKAVAAGRAHTIILTDK 262 K+F G D ++G H R N + + +KS C ++ ++ G +H+ + Sbjct: 1542 KLFSWGEGEDGKLG-HGNRMN------CDHPKLIDTFKS-SC-VRDMSCGSSHSAAILSS 1592 Query: 263 EGVYTLGNNAYGQCGRKVNVNEEYKGSMVTHNIQKLGKESIIDVCCG 403 +YT G YG+ G N + +Q +ID+ CG Sbjct: 1593 GELYTWGLGEYGRLGHGDNYTH-----LKPKKVQSFTSHRVIDIACG 1634 Score = 30.3 bits (65), Expect = 0.62 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +2 Query: 218 AVAAGRAHTIILTDKEGVYTLGNNAYGQCGR 310 A +G A T+ LTD + V++ G+ YG+ GR Sbjct: 2577 ACGSGDAQTLCLTDDDCVWSWGDGDYGKLGR 2607 Score = 29.9 bits (64), Expect = 0.82 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 209 EIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 307 ++ +A G H + TD VYT G+N GQ G Sbjct: 2678 KVITIATGSLHCVASTDTGEVYTWGDNDEGQLG 2710 Score = 28.7 bits (61), Expect = 1.9 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 209 EIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 307 +I VA G H + +TD V+ G+N +GQ G Sbjct: 1733 KIVDVAVGALHCLAVTDSGQVFAWGDNDHGQQG 1765 >SB_29134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 31.5 bits (68), Expect = 0.27 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 209 EIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCGRKVNVN 325 ++ + G HT ++TD +YT G N GQ G +N Sbjct: 87 DVLCITGGGGHTAMITDSRELYTCGWNNRGQLGLGDTIN 125 >SB_25012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 31.5 bits (68), Expect = 0.27 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 221 VAAGRAHTIILTDKEGVYTLGNNAYGQCG 307 + G AH++ L+D +Y+ G N+YGQ G Sbjct: 167 ILCGYAHSLALSDAGCIYSWGANSYGQLG 195 >SB_10740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 31.5 bits (68), Expect = 0.27 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +2 Query: 164 LSYAPIYIPYKSLECEIKAVAAGRAHTIILTDK--EGVYTLGNNAYGQCGR 310 L Y P+++P + CE RA++I LTD+ +G + Y CG+ Sbjct: 57 LGYPPMHVPAWQITCETLRSRDERAYSIQLTDRRNKGPRSSDVTCYNSCGK 107 >SB_6739| Best HMM Match : RCC1 (HMM E-Value=1.6e-34) Length = 1790 Score = 30.3 bits (65), Expect = 0.62 Identities = 17/65 (26%), Positives = 31/65 (47%) Frame = +2 Query: 209 EIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCGRKVNVNEEYKGSMVTHNIQKLGKESII 388 ++ ++ G H+ +T + +YT G YG+ G + ++ +V + L II Sbjct: 596 QVIRISCGSTHSAAVTSEGELYTWGRGNYGRLGHGSSEDQ-----LVPVLVSGLRGHHII 650 Query: 389 DVCCG 403 DV CG Sbjct: 651 DVACG 655 Score = 29.1 bits (62), Expect = 1.4 Identities = 18/61 (29%), Positives = 29/61 (47%) Frame = +2 Query: 221 VAAGRAHTIILTDKEGVYTLGNNAYGQCGRKVNVNEEYKGSMVTHNIQKLGKESIIDVCC 400 V+ G H + LTD VY G N GQ G ++ + ++V+ L + I+ + C Sbjct: 758 VSVGSIHCLALTDAGEVYCWGRNDQGQLG-DIDCQIRPEPTLVS----GLASKGIVGIAC 812 Query: 401 G 403 G Sbjct: 813 G 813 Score = 28.7 bits (61), Expect = 1.9 Identities = 19/62 (30%), Positives = 29/62 (46%) Frame = +2 Query: 218 AVAAGRAHTIILTDKEGVYTLGNNAYGQCGRKVNVNEEYKGSMVTHNIQKLGKESIIDVC 397 A +G AHT+ D V++ G+ YG+ GR ++ K +Q LG + V Sbjct: 653 ACGSGDAHTLAAADDGTVWSWGDGDYGKLGR--GGSDGCKNPKSIERLQGLG---VCKVY 707 Query: 398 CG 403 CG Sbjct: 708 CG 709 >SB_7970| Best HMM Match : RCC1 (HMM E-Value=0) Length = 651 Score = 29.9 bits (64), Expect = 0.82 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 212 IKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 307 + AV+AG H++ LT V+T G A+G+ G Sbjct: 234 VVAVSAGSGHSLALTADGAVFTWGFGAHGRLG 265 >SB_52263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1024 Score = 29.5 bits (63), Expect = 1.1 Identities = 15/61 (24%), Positives = 30/61 (49%) Frame = +2 Query: 218 AVAAGRAHTIILTDKEGVYTLGNNAYGQCGRKVNVNEEYKGSMVTHNIQKLGKESIIDVC 397 +++ GR ++ + + + NN C + EE++ S + H + +L + IID C Sbjct: 693 SMSLGRNVVVLTPENDLAHDHRNNPRILCIPEEKPIEEWRPSELGHKLDRLAEVIIIDEC 752 Query: 398 C 400 C Sbjct: 753 C 753 >SB_5067| Best HMM Match : RCC1 (HMM E-Value=4.5e-16) Length = 390 Score = 28.7 bits (61), Expect = 1.9 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +2 Query: 209 EIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 307 ++ +A G +HT+++T +++ GN GQ G Sbjct: 123 QVTHIACGSSHTLVITGDGRLFSWGNGNSGQLG 155 Score = 27.9 bits (59), Expect = 3.3 Identities = 15/55 (27%), Positives = 29/55 (52%) Frame = +2 Query: 191 YKSLECEIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCGRKVNVNEEYKGSMVTH 355 + S + +KA++ G +H++IL + T+GNN Y K ++ + + TH Sbjct: 326 FTSTDSCVKALSGGDSHSMILLHNGRLLTVGNN-YEVSDNKGDLKDRVQTDNHTH 379 >SB_42507| Best HMM Match : ResIII (HMM E-Value=0.75) Length = 1056 Score = 28.7 bits (61), Expect = 1.9 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S V H +++L + IID CC Sbjct: 710 EEWRPSEVGHKLERLAEVIIIDECC 734 >SB_49438| Best HMM Match : LIM (HMM E-Value=3.1) Length = 355 Score = 28.3 bits (60), Expect = 2.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + L +E IID CC Sbjct: 212 EEWRPSELGHKLDHLAEEIIIDECC 236 >SB_29698| Best HMM Match : DUF1610 (HMM E-Value=4.6) Length = 739 Score = 28.3 bits (60), Expect = 2.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L K IID CC Sbjct: 471 EEWRPSELGHKLDRLAKVIIIDECC 495 >SB_25283| Best HMM Match : LIM (HMM E-Value=1.1) Length = 1097 Score = 28.3 bits (60), Expect = 2.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L K IID CC Sbjct: 738 EEWRPSELGHKLDRLAKVIIIDECC 762 >SB_23543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 869 Score = 28.3 bits (60), Expect = 2.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L K IID CC Sbjct: 471 EEWRPSELGHKLDRLAKVIIIDECC 495 >SB_23438| Best HMM Match : zf-CCHC (HMM E-Value=0.00065) Length = 1275 Score = 28.3 bits (60), Expect = 2.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + L +E IID CC Sbjct: 522 EEWRPSELGHKLDHLAEEIIIDECC 546 >SB_10205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 985 Score = 28.3 bits (60), Expect = 2.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L K IID CC Sbjct: 652 EEWRPSELGHKLDRLAKVIIIDECC 676 >SB_12073| Best HMM Match : LIM (HMM E-Value=0.49) Length = 500 Score = 27.9 bits (59), Expect = 3.3 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + +IID CC Sbjct: 338 EEWRPSELGHKLDRLAEVNIIDECC 362 >SB_16849| Best HMM Match : RmlD_sub_bind (HMM E-Value=3.3) Length = 355 Score = 27.9 bits (59), Expect = 3.3 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + +IID CC Sbjct: 223 EEWRPSELGHKLDRLAEVTIIDECC 247 >SB_52418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 472 Score = 27.5 bits (58), Expect = 4.4 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 125 EEWRSSELGHKLDRLAEVIIIDECC 149 >SB_32347| Best HMM Match : RCC1 (HMM E-Value=0.00072) Length = 677 Score = 27.5 bits (58), Expect = 4.4 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +2 Query: 176 PIYIPYKSLECEIKAVAAGRAHTIILTDKEGVYTLGNNAYGQCG 307 P+Y+ S + + AV G H++ L+ + VY+ G +GQ G Sbjct: 58 PVYVTELS-DKKCIAVVCGHYHSLALSADQQVYSWGWGVHGQLG 100 >SB_42659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5834 Score = 27.1 bits (57), Expect = 5.8 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 296 GQCGRKVNVNEEYKGSMVTHNIQKLGKESI 385 GQCG VN N + G T+NI + + ++ Sbjct: 2691 GQCGEYVNPNCTFGGIRATYNISLMRQSTV 2720 >SB_33372| Best HMM Match : LRV (HMM E-Value=7) Length = 311 Score = 27.1 bits (57), Expect = 5.8 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +1 Query: 1 CRNSARGYKHSLWLRFHSSLNKNFRAAQSFRYRYQYRFPNWIPF 132 C+N G + +LR H ++ +FR S+R ++F N+ PF Sbjct: 128 CQNKDVGKDLTSFLRQHYVISSHFRPRISYRVELLFKFRNF-PF 170 >SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 27.1 bits (57), Expect = 5.8 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +2 Query: 122 GY-HSPRRNHPLELLLSYAPIYIPYKSLECEIKAVAAGRA 238 GY + PRR P + LL A PY S E A+ G A Sbjct: 75 GYKYKPRRRKPKQTLLKKAAYPFPYTSTEMAPHAMKMGYA 114 >SB_14412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 27.1 bits (57), Expect = 5.8 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 619 EEWRPSKLGHKLDRLAEVIIIDECC 643 >SB_1228| Best HMM Match : PKD_channel (HMM E-Value=0) Length = 1157 Score = 27.1 bits (57), Expect = 5.8 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 94 YRYQYRFPNWIPFTTTKSSFGT 159 YR Y P WIP T T S +G+ Sbjct: 596 YRTSYNLPKWIPVTNT-SHYGS 616 >SB_56605| Best HMM Match : WD40 (HMM E-Value=2.5e-12) Length = 630 Score = 27.1 bits (57), Expect = 5.8 Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 2/81 (2%) Frame = +2 Query: 128 HSPRRNHPLELLLSYAPIYIPYKSLECEIKAVAAGRAHTI--ILTDKEGVYTLGNNAYGQ 301 H P+R E +S P+ Y+ L EI+A H I I T+ V+T +G Sbjct: 452 HLPKREGKSEHFMSAFPLTC-YR-LSGEIRA----HRHPINAIATNSSCVFTASKFFWGG 505 Query: 302 CGRKVNVNEEYKGSMVTHNIQ 364 RK V EY+G V ++ Sbjct: 506 YNRKSGVEYEYRGIFVCFGLK 526 >SB_48227| Best HMM Match : DEAD (HMM E-Value=1.6) Length = 362 Score = 27.1 bits (57), Expect = 5.8 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 75 EEWRPSELGHKLDRLAEAIIIDECC 99 >SB_12490| Best HMM Match : DEAD (HMM E-Value=1.6) Length = 445 Score = 27.1 bits (57), Expect = 5.8 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 75 EEWRPSELGHKLDRLAEAIIIDECC 99 >SB_12136| Best HMM Match : ResIII (HMM E-Value=0.24) Length = 1118 Score = 27.1 bits (57), Expect = 5.8 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 903 EEWRTSELRHKLDRLAEVIIIDECC 927 >SB_58837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 747 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 469 EEWRPSELGHKLDRLAEVIIIDECC 493 >SB_58231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 46 EEWRPSELGHKLDRLAEVIIIDECC 70 >SB_57874| Best HMM Match : LIM (HMM E-Value=0.44) Length = 1037 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 691 EEWRPSELGHKLDRLAEVIIIDECC 715 >SB_56636| Best HMM Match : Toxin_4 (HMM E-Value=2.4) Length = 434 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 202 EEWRPSELGHKLDRLAEVIIIDECC 226 >SB_56579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1042 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 728 EEWRPSELGHKLDRLAEVLIIDECC 752 >SB_56070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 381 EEWRPSELGHKLDRLAEVIIIDECC 405 >SB_55623| Best HMM Match : ResIII (HMM E-Value=0.17) Length = 755 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 394 EEWRPSELGHKLDRLAEVVIIDECC 418 >SB_53418| Best HMM Match : zf-CCHC (HMM E-Value=8.2) Length = 196 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 171 EEWRPSELGHKLDRLAEVIIIDECC 195 >SB_53009| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 63 EEWRPSELGHKLDRLAEVIIIDECC 87 >SB_48939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 510 EEWRPSELGHKLDRLAEVIIIDECC 534 >SB_48848| Best HMM Match : DUF1213 (HMM E-Value=8) Length = 148 Score = 26.6 bits (56), Expect = 7.7 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -1 Query: 379 FLSKLLYVMSHHTTFI 332 F+++ LYVMSHH T + Sbjct: 109 FMTRSLYVMSHHVTVV 124 >SB_42413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 26.6 bits (56), Expect = 7.7 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 147 ILWNFCLAMHLFIYLTRAWSVRLKQWQ 227 I+W F L +HL Y+T R+K+W+ Sbjct: 421 IVWIFMLPVHLAFYVTMP-DCRVKKWE 446 >SB_40361| Best HMM Match : ResIII (HMM E-Value=0.42) Length = 1127 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 624 EEWRPSELGHKLDRLAEVIIIDECC 648 >SB_38724| Best HMM Match : DUF1684 (HMM E-Value=2.2) Length = 373 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 6 EEWRPSELGHKLDRLAEVVIIDECC 30 >SB_37849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1213 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 815 EEWRPSELGHKLDRLAEVIIIDECC 839 >SB_36713| Best HMM Match : ResIII (HMM E-Value=1) Length = 433 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 389 EEWRPSELGHKLDRLAEVIIIDECC 413 >SB_36584| Best HMM Match : ResIII (HMM E-Value=0.95) Length = 1244 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 841 EEWRPSELGHKLDRLAEVIIIDECC 865 >SB_34067| Best HMM Match : SPAN-X (HMM E-Value=2.7) Length = 207 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 182 EEWRPSELGHKLDRLAEVIIIDECC 206 >SB_33051| Best HMM Match : PADR1 (HMM E-Value=1.2) Length = 1066 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 644 EEWRPSELGHKLDRLAEVIIIDECC 668 >SB_32248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1023 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 817 EEWRPSELGHKLDRLAEVIIIDECC 841 >SB_31605| Best HMM Match : ResIII (HMM E-Value=0.44) Length = 488 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 181 EEWRPSELGHKLDRLAEVIIIDECC 205 >SB_31020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 680 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 313 EEWRPSELGHKLDRLAEVIIIDECC 337 >SB_30838| Best HMM Match : ResIII (HMM E-Value=0.13) Length = 327 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 146 EEWRPSELGHKLDRLAEVIIIDECC 170 >SB_29680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1194 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 886 EEWRPSELGHKLDRLAEVIIIDECC 910 >SB_25765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 278 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 46 EEWRPSELGHKLDRLAEVIIIDECC 70 >SB_25687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 877 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 480 EEWRPSELGHKLDRLAEVIIIDECC 504 >SB_25225| Best HMM Match : DEAD (HMM E-Value=1.4) Length = 534 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 410 EEWRPSELGHKLDRLAEVLIIDECC 434 >SB_24603| Best HMM Match : GatB_Yqey (HMM E-Value=0.7) Length = 984 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 614 EEWRPSELGHKLDRLAEVIIIDECC 638 >SB_22826| Best HMM Match : F5_F8_type_C (HMM E-Value=7.9e-09) Length = 1296 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 1187 EEWRPSELGHKLDRLAEVIIIDECC 1211 >SB_21868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 384 EEWRPSELGHKLDRLSEVIIIDECC 408 >SB_20530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 362 EEWRPSELGHKLDRLAEVIIIDECC 386 >SB_19858| Best HMM Match : DEAD (HMM E-Value=0.61) Length = 257 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 65 EEWRPSELGHKLDRLAEVIIIDECC 89 >SB_18996| Best HMM Match : zf-C4_Topoisom (HMM E-Value=3.5) Length = 475 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 63 EEWRPSELGHKLDRLAEVIIIDECC 87 >SB_17225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 8 EEWRPSELGHKLDRLAEVIIIDECC 32 >SB_16351| Best HMM Match : LIM (HMM E-Value=8.8) Length = 199 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 40 EEWRPSELGHKLDRLAEVIIIDECC 64 >SB_15676| Best HMM Match : ResIII (HMM E-Value=4.5) Length = 349 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 196 EEWRPSELGHKLDRLAEVIIIDECC 220 >SB_15299| Best HMM Match : LIM (HMM E-Value=0.44) Length = 344 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 63 EEWRLSELVHKLDRLAEVIIIDECC 87 >SB_14541| Best HMM Match : ResIII (HMM E-Value=0.66) Length = 822 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 579 EEWRPSELGHKLDRLAEVIIIDECC 603 >SB_13306| Best HMM Match : PADR1 (HMM E-Value=1.2) Length = 967 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 545 EEWRPSELGHKLDRLAEVIIIDECC 569 >SB_12992| Best HMM Match : LIM (HMM E-Value=0.16) Length = 411 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 46 EEWRPSELGHKLDRLAEVIIIDECC 70 >SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3133 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 2924 EEWRPSELGHKLDRLAEVIIIDECC 2948 >SB_7382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1120 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 742 EEWRPSELGHKLDRLAEVIIIDECC 766 >SB_7068| Best HMM Match : ResIII (HMM E-Value=0.29) Length = 1131 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 871 EEWRPSELGHKLDRLAEVIIIDECC 895 >SB_5396| Best HMM Match : DEAD (HMM E-Value=0.73) Length = 1017 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 764 EEWRPSELGHKLDRLAEVIIIDECC 788 >SB_3753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 976 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 648 EEWRPSELGHKLDRLAEVIIIDECC 672 >SB_3590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 438 Score = 26.6 bits (56), Expect = 7.7 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 299 QCGRKVNVNEEYKGSMVTHNIQKLGKESIIDVC 397 +CG+ N + E K ++TH+ QK K ++ D C Sbjct: 194 ECGKCFNQSGEVKIHLMTHSGQKPYKCNVCDKC 226 >SB_3096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 994 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 678 EEWRPSELGHKLDRLAEVIIIDECC 702 >SB_1473| Best HMM Match : DUF551 (HMM E-Value=1.6) Length = 917 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 617 EEWRPSELGHKLDRLAEVIIIDECC 641 >SB_474| Best HMM Match : dsrm (HMM E-Value=3.2e-20) Length = 918 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 685 EEWRPSELWHKLDRLAEVIIIDECC 709 >SB_366| Best HMM Match : ResIII (HMM E-Value=0.28) Length = 1104 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 847 EEWRPSELGHKLDRLAEVIIIDECC 871 >SB_59747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1064 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 851 EEWRPSELGHKLDRLAEVIIIDECC 875 >SB_59553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1003 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 626 EEWRPSELGHKLDRLAEVIIIDECC 650 >SB_58744| Best HMM Match : ResIII (HMM E-Value=0.14) Length = 831 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 478 EEWRPSELWHKLDRLAEVIIIDECC 502 >SB_56794| Best HMM Match : ResIII (HMM E-Value=0.63) Length = 532 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 146 EEWRPSELGHKLDRLAEVIIIDECC 170 >SB_53226| Best HMM Match : ResIII (HMM E-Value=0.45) Length = 880 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 717 EEWRPSELGHKLDRLAEVIIIDECC 741 >SB_53060| Best HMM Match : ResIII (HMM E-Value=0.14) Length = 1248 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 850 EEWRPSELGHKLDRLAEVIIIDECC 874 >SB_51131| Best HMM Match : ResIII (HMM E-Value=0.36) Length = 738 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 574 EEWRPSELGHKLDRLAEVIIIDECC 598 >SB_49508| Best HMM Match : ResIII (HMM E-Value=1.3) Length = 666 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H ++ L + IID CC Sbjct: 589 EEWRPSELGHKLESLAEVIIIDECC 613 >SB_48412| Best HMM Match : ResIII (HMM E-Value=0.19) Length = 1390 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 992 EEWRPSELGHKLDRLAEVIIIDECC 1016 >SB_48295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1269 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 871 EEWRPSELGHKLDRLAEVIIIDECC 895 >SB_46734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 63 EEWRPSELGHKLDRLAEVIIIDECC 87 >SB_46041| Best HMM Match : LIM (HMM E-Value=1.5) Length = 1236 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 838 EEWRPSELGHKLDRLAEVIIIDECC 862 >SB_45084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 368 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 343 EEWRPSELGHKLDRLAEVIIIDECC 367 >SB_44949| Best HMM Match : LIM (HMM E-Value=0.44) Length = 595 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 221 EEWRPSELGHKLDRLAEVIIIDECC 245 >SB_43215| Best HMM Match : ResIII (HMM E-Value=7.9) Length = 235 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 63 EEWRPSELGHKLDRLAEVIIIDECC 87 >SB_39998| Best HMM Match : Peptidase_C1 (HMM E-Value=0) Length = 1220 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 975 EEWRPSELGHKLDRLAEVIIIDECC 999 >SB_39663| Best HMM Match : ResIII (HMM E-Value=1.1) Length = 1143 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 758 EEWRPSELGHKLDRLAEVIIIDECC 782 >SB_38419| Best HMM Match : ResIII (HMM E-Value=0.48) Length = 385 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 232 EEWRPSELGHKLDRLAEVIIIDECC 256 >SB_37597| Best HMM Match : ResIII (HMM E-Value=0.28) Length = 658 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 356 EEWRPSELGHKLDRLAEVIIIDECC 380 >SB_37416| Best HMM Match : ResIII (HMM E-Value=1.2) Length = 563 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 450 EEWRPSELGHKLDRLAEVIIIDECC 474 >SB_36888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 296 EEWRPSELGHKLDRLAEVLIIDECC 320 >SB_36328| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1526 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 1419 EEWRPSELGHKLDRLAEVIIIDECC 1443 >SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) Length = 1042 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 773 EEWRPSELGHKLDRLAEVIIIDECC 797 >SB_35990| Best HMM Match : ResIII (HMM E-Value=2) Length = 798 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 689 EEWRPSELGHKLDRLAEVIIIDECC 713 >SB_34841| Best HMM Match : ResIII (HMM E-Value=1.6) Length = 949 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 791 EEWRPSELWHKLDRLAEVIIIDECC 815 >SB_32075| Best HMM Match : LIM (HMM E-Value=0.44) Length = 789 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 398 EEWRPSELGHKLDRLAEVIIIDECC 422 >SB_31943| Best HMM Match : ResIII (HMM E-Value=1.6) Length = 1053 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 536 EEWRPSELGHKLDRLAEVIIIDECC 560 >SB_31820| Best HMM Match : CG-1 (HMM E-Value=2.4) Length = 992 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 728 EEWRPSELGHKLDRLAEVIIIDECC 752 >SB_31538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 676 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 276 EEWRPSELGHKLDRLAEVIIIDECC 300 >SB_31160| Best HMM Match : FeThRed_B (HMM E-Value=4.1) Length = 828 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 432 EEWRPSELGHKLDRLAEVIIIDECC 456 >SB_31030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1009 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 702 EEWRPSELGHKLDRLAEVIIIDECC 726 >SB_29335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 840 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 474 EEWRPSELGHKLDRLAEVIIIDECC 498 >SB_27544| Best HMM Match : ResIII (HMM E-Value=0.14) Length = 522 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 146 EEWRPSELWHKLDRLAEVIIIDECC 170 >SB_27423| Best HMM Match : ResIII (HMM E-Value=0.56) Length = 562 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 356 EEWRPSELGHKLDRLAEVIIIDECC 380 >SB_27319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1099 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 705 EEWRPSELGHKLDRLAEVIIIDECC 729 >SB_27311| Best HMM Match : DEAD (HMM E-Value=0.17) Length = 1178 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 778 EEWRPSELGHKLDRLAEVIIIDECC 802 >SB_27173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1206 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 852 EEWRPSELGHKLDRLAEVIIIDECC 876 >SB_25592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 730 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 334 EEWRPSELGHKLDRLAEVIIIDECC 358 >SB_24587| Best HMM Match : ResIII (HMM E-Value=0.82) Length = 250 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 206 EEWRPSELGHKLDRLAEVIIIDECC 230 >SB_24295| Best HMM Match : DUF1070 (HMM E-Value=3.9) Length = 745 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 633 EEWRPSELGHKLDRLAEVIIIDECC 657 >SB_24250| Best HMM Match : ResIII (HMM E-Value=3.6) Length = 842 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 750 EEWRPSELGHKLDRLAEVIIIDECC 774 >SB_23847| Best HMM Match : Steroid_dh (HMM E-Value=1.9) Length = 191 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 166 EEWRPSELGHKLDRLAEVIIIDECC 190 >SB_16070| Best HMM Match : IncA (HMM E-Value=0.43) Length = 895 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 396 EEWRPSELGHKLDRLAEVIIIDECC 420 >SB_15115| Best HMM Match : ResIII (HMM E-Value=0.24) Length = 1179 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 793 EEWRPSELGHKLDRLAEVIIIDECC 817 >SB_13172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 599 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 342 EEWRPSELGHKLDRLAEVIIIDECC 366 >SB_12717| Best HMM Match : CheR (HMM E-Value=5.6) Length = 685 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 597 EEWRPSELGHKLDRLAEVIIIDECC 621 >SB_12589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1255 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 924 EEWRPSELGHKLDRLAEVIIIDECC 948 >SB_11769| Best HMM Match : Complex1_17_2kD (HMM E-Value=6.6) Length = 355 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 330 EEWRPSELGHKLDRLAEVIIIDECC 354 >SB_7073| Best HMM Match : ResIII (HMM E-Value=0.083) Length = 1105 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 763 EEWRPSELGHKLDRLAEVIIIDECC 787 >SB_7013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 713 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 613 EEWRPSELGHKLDRLAEVIIIDECC 637 >SB_5569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 429 EEWRPSELGHKLDRLAEVIIIDECC 453 >SB_5505| Best HMM Match : ResIII (HMM E-Value=0.55) Length = 1346 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 947 EEWRPSELGHKLDRLAEVIIIDECC 971 >SB_3287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1030 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 735 EEWRPSELGHKLDRLAEVIIIDECC 759 >SB_2770| Best HMM Match : ResIII (HMM E-Value=2.2) Length = 928 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 620 EEWRPSELGHKLDRLAEVIIIDKCC 644 >SB_2121| Best HMM Match : ResIII (HMM E-Value=0.46) Length = 1106 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 815 EEWRPSELGHKLDRLAEVIIIDECC 839 >SB_2065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 619 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 364 EEWRPSELGHKLDRLAEVIIIDECC 388 >SB_1431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1748 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 1459 EEWRPSELGHKLDRLAEVLIIDECC 1483 >SB_204| Best HMM Match : ResIII (HMM E-Value=1.2) Length = 244 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 326 EEYKGSMVTHNIQKLGKESIIDVCC 400 EE++ S + H + +L + IID CC Sbjct: 208 EEWRPSELGHKLDRLAEVIIIDECC 232 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,685,192 Number of Sequences: 59808 Number of extensions: 255226 Number of successful extensions: 852 Number of sequences better than 10.0: 145 Number of HSP's better than 10.0 without gapping: 795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 850 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 727815563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -